Thera-SAbDab

SPARTALIZUMAB

> Structural Summary

Therapeutic	Spartalizumab
Target	PDCD1
Heavy Chain	EVQLVQSGAEVKKPGESLRISCKGSGYTFTTYWMHWVRQATGQGLEWMGNIYPGTGGSNFDEKFKNRVTITADKSTSTAYMELSSLRSEDTAVYYCTRWTTGTGAYWGQGTTVTVSS
Light Chain	EIVLTQSPATLSLSPGERATLSCKSSQSLLDSGNQKNFLTWYQQKPGQAPRLLIYWASTRESGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQNDYSYPYTFGQGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (October '21)	Phase-II
Estimated Status (October '21)	Active
Recorded Developmental Technology	na
INN Year Proposed	2017
INN Year Recommended	2018
Companies Involved	Asan Medical Center, Dana-Farber Cancer Institute, Novartis, Novartis Oncology, Palobiofarma, Seoul National University Hospital
Conditions Approved	na
Conditions Active	Malignant melanoma, Breast cancer, Colorectal cancer, Diffuse large B cell lymphoma, Gastric cancer, Nasopharyngeal cancer, Non-small cell lung cancer, Solid tumours, Acute myeloid leukaemia, Cancer, Liver cancer, Lymphoma, Multiple myeloma, Myelodysplastic syndromes, Ovarian cancer, Pancreatic cancer, Renal cancer
Conditions Discontinued	Neuroendocrine tumours
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy