Thera-SAbDab

VIBECOTAMAB

>   Structural Summary
TherapeuticVibecotamab
Target 1IL3RA
Heavy Chain 1QVQLQQSGAEVKKPGASVKVSCKASGYTFTDYYMKWVKQSHGKSLEWMGDIIPSNGATFYNQKFKGKATLTVDRSTSTAYMELSSLRSEDTAVYYCARSHLLRASWFAYWGQGTLVTVSS
Light Chain 1DFVMTQSPDSLAVSLGERATINCKSSQSLLNTGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSLQAEDVAVYYCQNDYSYPYTFGGGTKLEIK
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CD3E
Heavy Chain 2EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMNWVRQAPGKGLEWVGRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCVRHGNFGDSYVSWFAYWGQGTLVTVSS
Light Chain 2QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQQKPGKSPRGLIGGTNKRAPGVPARFSGSLLGGKAALTISGAQPEDEADYYCALWYSNHWVFGGGTKLTVLEPK
100% seqID Fv 2 StructureNone
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific Mixed mAb and scFv
IsotypeG1;G1
Highest Clinical Trial (October '21)Phase-I
Estimated Status (October '21)Active
Recorded Developmental Technologyna
INN Year Proposed2018
INN Year Recommended2019
Companies InvolvedXencor
Conditions Approvedna
Conditions ActiveHaematological malignancies
Conditions Discontinuedna
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy