Thera-SAbDab

PEPINEMAB

> Structural Summary

Therapeutic	Pepinemab
Target	SEMA4D
Heavy Chain	QVQLVQSGAEVKKPGSSVKVSCKASGYSFSDYYMHWVRQAPGQGLEWMGQINPTTGGASYNQKFKGKATITVDKSTSTAYMELSSLRSEDTAVYYCARYYYGRHFDVWGQGTTVTVSS
Light Chain	DIVMTQSPDSLAVSLGERATINCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYAASNLESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPYTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (June '19)	Phase-II
Estimated Status (June '19)	Active
Recorded Developmental Technology	na
INN Year Proposed	2018
INN Year Recommended	2019
Companies Involved	Bristol-Myers Squibb, Children's Oncology Group, Emory University, Merck KGaA, National Cancer Institute (USA), Teva Pharmaceutical Industries, UCLAs Jonsson Comprehensive Cancer Center, Vaccinex
Conditions Approved	na
Conditions Active	Huntington's disease, Non-small cell lung cancer, Osteosarcoma, Solid tumours, Colorectal cancer, Head and neck cancer, Malignant melanoma, Pancreatic cancer
Conditions Discontinued	Multiple sclerosis
Notes

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]