Thera-SAbDab

GLOFITAMAB

>   Structural Summary
TherapeuticGlofitamab
Target 1CD3E
Heavy Chain 1EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCVRHGNFGNSYVSWFAYWGQGTLVTVSS
Light Chain 1QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTTSNYANWVQEKPGQAFRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNLWVFGGGTKLTVL
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2MS4A1
Heavy Chain 2QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNVFDGYWLVYWGQGTLVTVSS
Light Chain 2DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPYTFGGGTKVEIK
100% seqID Fv 2 Structure3pp3 [Fvs: HL], 3pp4 [Fvs: HL]
99% seqID Fv 2 Structure6y9a [Fvs: HL]
95-98% seqID Fv 2 Structure6y97 [Fvs: HL]
>   Alignments

Non-identical sequences have been numbered using the Chothia scheme and aligned to Glofitamab.
CDR positions are indicated in blue. Mismatching positions are highlighted in orange.

Sequence identity: 99.57%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 101 102 103 104 105 106 107 108 109 110 111 112 113
glofitamab2 Q V Q L V Q S G A E V K K P G S S V K V S C K A S G Y A F S Y S W I N W V R Q A P G Q G L E W M G R I F P G D G D T D Y N G K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R N V F D G Y W L V Y W G Q G T L V T V S S
6y9a - V Q L V Q S G A E V K K P G S S V K V S C K A S G Y A F S Y S W I N W V R Q A P G Q G L E W M G R I F P G D G D T D Y N G K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R N V F D G Y W L V Y W G Q G T L V T V S S

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 30A 30B 30C 30D 30E 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
glofitamab2 D I V M T Q T P L S L P V T P G E P A S I S C R S S K S L L H S N G I T Y L Y W Y L Q K P G Q S P Q L L I Y Q M S N L V S G V P D R F S G S G S G T D F T L K I S R V E A E D V G V Y Y C A Q N L E L P Y T F G G G T K V E I K
6y9a D I V M T Q T P L S L P V T P G E P A S I S C R S S K S L L H S N G I T Y L Y W Y L Q K P G Q S P Q L L I Y Q M S N L V S G V P D R F S G S G S G T D F T L K I S R V E A E D V G V Y Y C A Q N L E L P Y T F G G G T K V E I K
Sequence identity: 97.84%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 101 102 103 104 105 106 107 108 109 110 111 112 113
glofitamab_Fv2 Q V Q L V Q S G A E V K K P G S S V K V S C K A S G Y A F S Y S W I N W V R Q A P G Q G L E W M G R I F P G D G D T D Y N G K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R N V F D G Y W L V Y W G Q G T L V T V S S
6y97 - V Q L V Q S G A E V K K P G S S V K V S C K A S G Y A F S Y S W I N W V R Q A P G Q G L E W M G R I F P G D G D T D Y N G K F K G R V T I T A D K S T S T A Y M E L S S L R S E D T A V Y Y C A R N V F D G Y W L V Y W G Q G T L V T V - -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 30A 30B 30C 30D 30E 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
glofitamab_Fv2 D I V M T Q T P L S L P V T P G E P A S I S C R S S K S L L H S N G I T Y L Y W Y L Q K P G Q S P Q L L I Y Q M S N L V S G V P D R F S G S G S G T D F T L K I S R V E A E D V G V Y Y C A Q N L E L P Y T F G G G T K V E I K
6y97 D I V M T Q T P L S L P V T P G E P A S I S C R S S K S L L H S N G I T Y L Y W Y L Q K P G Q S P Q L L I Y Q M S N L V S G V P D R F S G S G S G T D F T L K I S R V E A E D V G V Y Y C A Q N L E L P Y T F G G G T K V E - -
>   Metadata
FormatBispecific mAb with Domain Crossover
IsotypeG1;G1
Highest Clinical Trial (October '21)Phase-III
Estimated Status (October '21)Active
Recorded Developmental Technologyna
INN Year Proposed2019
INN Year Recommended2020
Companies InvolvedRoche
Conditions Approvedna
Conditions ActiveDiffuse large B cell lymphoma, Follicular lymphoma, Non-Hodgkin's lymphoma
Conditions Discontinuedna
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy