Thera-SAbDab

IVUXOLIMAB

> Structural Summary

Therapeutic	Ivuxolimab
Target	TNFRSF4
Heavy Chain	EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYISSSSSTIDYADSVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCARESGWYLFDYWGQGTLVTVSS
Light Chain	DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPPTFGGGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G2
Highest Clinical Trial (June '19)	Phase-II
Estimated Status (June '19)	Active
Recorded Developmental Technology	na
INN Year Proposed	2019
INN Year Recommended	2020
Companies Involved	Pfizer, Dana-Farber Cancer Institute, M. D. Anderson Cancer Center, National Cancer Institute USA, University of Southern California
Conditions Approved	na
Conditions Active	Breast cancer, Renal cell carcinoma, Solid tumours, Acute myeloid leukaemia, Squamous cell cancer, Follicular lymphoma
Conditions Discontinued	na
Notes

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]