Thera-SAbDab

BAVUNALIMAB

>   Structural Summary
TherapeuticBavunalimab
Target 1LAG3
Heavy Chain 1EVQLVESGGGLVQPGGSLRLSCASSGFTFDDAWMSWVRQAPGKGLEWVAEISTKANNHATYYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTAVYYCTRLATWDWYFDVWGQGTTVTVSS
Light Chain 1DIVLTQSPSSLSASVGDRVTITCRASQSVDYDGDSYMNWYQQKPGKPPKLLIYAASELESGIPARFSGSGSGTDFTLTISSLQPEDFATYYCQQSNEDPFTFGSGTKLEIK
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CTLA4
Heavy Chain 2EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVSFISYDGNYKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGHLGPFDLWGQGTMVTVSS
Light Chain 2EIVLTQSPATLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIK
100% seqID Fv 2 StructureNone
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific Mixed mAb and scFv
IsotypeG1;na
Highest Clinical Trial (October '21)Phase-I
Estimated Status (October '21)Active
Recorded Developmental Technologyna
INN Year Proposed2020
INN Year Recommended2021
Companies InvolvedXencor
Conditions Approvedna
Conditions ActiveSolid tumours
Conditions Discontinuedna
NotesBavunalimab is the new name for Pavunalimab (PL125)

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy