Therapeutic | Erfonrilimab |
Target 1 | CD274 |
Heavy Chain 1 | QVQLVEQSGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS |
Light Chain 1 | na |
100% seqID Fv 1 Structure | None |
99% seqID Fv 1 Structure | None |
95-98% seqID Fv 1 Structure | None |
Target 2 | CTLA4 |
Heavy Chain 2 | QVQLVESGGGLVQPGGSLRLSCAASGYIYSAYCMGWFRQAPGKGLEGVAAIYIGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADVIPTETCLGGSWSGPFGYWGQGTLVTVSS |
Light Chain 2 | na |
100% seqID Fv 2 Structure | 6rqm [Fvs: B] |
99% seqID Fv 2 Structure | None |
95-98% seqID Fv 2 Structure | None |
100% seqID Structure [Fv 2] | 6rqm [Fvs: B] |
There are no identical PDB matches to at least one Fv in this therapeutic. Click the links to build models with ABodyBuilder: [Fv 1] [Fv 2] |
Follow these links to our prediction tools:
Format | Bispecific Single Domains (VH-VH'-CH) |
Isotype | G1 |
Highest Clinical Trial (October '21) | Phase-II |
Estimated Status (October '21) | Active |
Recorded Developmental Technology | na |
INN Year Proposed | 2020 |
INN Year Recommended | None |
Companies Involved | Alphamab |
Conditions Approved | na |
Conditions Active | Non-small cell lung cancer, Triple-negative breast cancer, Esophageal carcinoma |
Conditions Discontinued | na |
Notes |
SAbDab papers
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]
Thera-SAbDab paper
Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]