Thera-SAbDab

ERFONRILIMAB

>   Structural Summary
TherapeuticErfonrilimab
Target 1CD274
Heavy Chain 1QVQLVEQSGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS
Light Chain 1na
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CTLA4
Heavy Chain 2QVQLVESGGGLVQPGGSLRLSCAASGYIYSAYCMGWFRQAPGKGLEGVAAIYIGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADVIPTETCLGGSWSGPFGYWGQGTLVTVSS
Light Chain 2na
100% seqID Fv 2 Structure6rqm [Fvs: B]
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific Single Domains (VH-VH'-CH)
IsotypeG1
Highest Clinical Trial (October '21)Phase-II
Estimated Status (October '21)Active
Recorded Developmental Technologyna
INN Year Proposed2020
INN Year RecommendedNone
Companies InvolvedAlphamab
Conditions Approvedna
Conditions ActiveNon-small cell lung cancer, Triple-negative breast cancer, Esophageal carcinoma
Conditions Discontinuedna
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy