Thera-SAbDab

ERFONRILIMAB

> Structural Summary

Therapeutic	Erfonrilimab
Target 1	CD274
Heavy Chain 1	QVQLVEQSGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS
Light Chain 1	na
100% seqID Fv 1 Structure	None
99% seqID Fv 1 Structure	None
95-98% seqID Fv 1 Structure	None
Target 2	CTLA4
Heavy Chain 2	QVQLVESGGGLVQPGGSLRLSCAASGYIYSAYCMGWFRQAPGKGLEGVAAIYIGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADVIPTETCLGGSWSGPFGYWGQGTLVTVSS
Light Chain 2	na
100% seqID Fv 2 Structure	6rqm [Fvs: B]
99% seqID Fv 2 Structure	None
95-98% seqID Fv 2 Structure	None

100% seqID Structure [Fv 2]	6rqm [Fvs: B]
There are no identical PDB matches to at least one Fv in this therapeutic. Click the links to build models with ABodyBuilder: [Fv 1] [Fv 2]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder: [Fv 1] [Fv 2]
Test for possible therapeutic developability issues with TAP: [Fv 1] [Fv 2]
Assign canonical forms by sequence with SCALOP: [Fv 1] [Fv 2]
Number the sequences in any numbering scheme with ANARCI: [Fv 1 H] [Fv 1 L] [Fv 2 H] [Fv 2 L]

Format	Bispecific Single Domains (VH-VH'-CH)
Isotype	G1
Highest Clinical Trial (October '21)	Phase-II
Estimated Status (October '21)	Active
Recorded Developmental Technology	na
INN Year Proposed	2020
INN Year Recommended	None
Companies Involved	Alphamab
Conditions Approved	na
Conditions Active	Non-small cell lung cancer, Triple-negative breast cancer, Esophageal carcinoma
Conditions Discontinued	na
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy