Therapeutic | Plonmarlimab |
Target | CSF2 |
Heavy Chain | EVQLVQSGAEVKKPGASVKVSCKASGYTFTSHYLHWVRQAPGQGLEWMGWIFPGDDKTKYNEKFKGRVTMTSDTSISTAYMELSRLRSDDTAVYYCARGTKYLNWNFDVWGQGTTVTVSS |
Light Chain | DIQLTQSPSFLSASVGDRVTITCKANQNVGTTLAWYQQKPGKSPKALIYSASYRYSGVPDRFSGSGSGTDFTLTISSLQPEDFATYFCHQYTTYPLTFGGGTKVEIK |
100% seqID Fv Structure | None |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
Format | Whole mAb |
Isotype | G1 |
Highest Clinical Trial (August '23) | Phase-II/III |
Estimated Status (August '23) | Active |
Recorded Developmental Technology | na |
INN Year Proposed | 2020 |
INN Year Recommended | None |
Companies Involved | I-Mab Biopharma |
Conditions Approved | na |
Conditions Active | Rheumatoid arthritis, COVID-19, Osteoarthritis |
Conditions Discontinued | na |
Notes | (June '22: Corrected FWL4 sequence) |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]