Thera-SAbDab

IZALONTAMAB

>   Structural Summary
TherapeuticIzalontamab
Target 1EGFR
Heavy Chain 1QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSS
Light Chain 1DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELK
100% seqID Fv 1 Structure5esq [Fvs: BA, DC], 5etu [Fvs: BA, DC], 5euk [Fvs: BA, DC], 5f88 [Fvs: BA, DC], 5ff6 [Fvs: BA, DC], 5hpm [Fvs: BA, DC], 5hyq [Fvs: BA, DC], 5i2i [Fvs: BA, DC], 5i76 [Fvs: BA, DC], 5icx [Fvs: BA, DC], 5icz [Fvs: BA, DC], 5id1 [Fvs: BA, DC], 5iop [Fvs: BA, DC], 5ir1 [Fvs: BA, DC], 5itf [Fvs: BA, DC], 5iv2 [Fvs: BA, DC], 5ivz [Fvs: BA, DC], 5t1k [Fvs: BA, DC], 5t1l [Fvs: BA, DC], 5th2 [Fvs: BA, DC]
99% seqID Fv 1 Structure1yy8 [Fvs: BA, DC], 1yy9 [Fvs: DC], 4gw1 [Fvs: BA, DC], 4gw5 [Fvs: BA, DC], 4kro [Fvs: DC], 4krp [Fvs: DC], 5icy [Fvs: BA, DC], 5id0 [Fvs: BA, DC], 5t1m [Fvs: BA, DC], 6au5 [Fvs: BA, DC], 6axp [Fvs: BA, DC], 6ayn [Fvs: BA, DC], 6azk [Fvs: BA, DC], 6azl [Fvs: BA, DC]
95-98% seqID Fv 1 Structure5gz0 [Fvs: BA, DC], 6arp [Fvs: BA, DC], 6aru [Fvs: CB]
Target 2ERBB3
Heavy Chain 2QVQLQESGGGLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANINRDGSASYYVDSVKGRFTISRDDAKNSLYLQMNSLRAEDTAVYYCARDRGVGYFDLWGRGTLVTVSS
Light Chain 2QSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYQQHPGKAPKLMIYDVSDRPSGVSDRFSGSKSGNTASLIISGLQADDEADYYCSSYGSSSTHVIFGGGTKVTVL
100% seqID Fv 2 StructureNone
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Alignments

Non-identical sequences have been numbered using the Chothia scheme and aligned to Izalontamab.
CDR positions are indicated in blue. Mismatching positions are highlighted in orange.

Sequence identity: 99.56%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6ayn Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6ayn D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.56%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6azl Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6azl D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.56%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6au5 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6au5 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.56%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6axp Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6axp D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.56%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6azk Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6azk D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.11%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
5icy E V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
5icy D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.11%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
5t1m E V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
5t1m D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 99.11%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
5id0 E V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
5id0 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
1yy8 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
1yy8 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
4gw5 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
4gw5 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
1yy9 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
1yy9 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
4gw1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
4gw1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
4kro Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
4kro D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 98.23%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 52A 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab Fv 1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W - S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
4krp Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G - G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab Fv 1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
4krp D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 97.79%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab_Fv1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6arp Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F D L T D Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab_Fv1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6arp D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A D E S I D G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 97.79%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab_Fv1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
6aru Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F D L T D Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S A

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab_Fv1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
6aru D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A D E S I D G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
Sequence identity: 97.78%

Heavy chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 82A 82B 82C 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 100A 100B 100C 101 102 103 104 105 106 107 108 109 110 111 112 113
izalontamab_Fv1 Q V Q L K Q S G P G L V Q P S Q S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S S
5gz0 Q V Q L K Q S G P G L V Q P G G S L S I T C T V S G F S L T N Y G V H W V R Q S P G K G L E W L G V I W S G G N T D Y N T P F T S R L S I N K D N S K S Q V F F K M N S L Q S N D T A I Y Y C A R A L T Y Y D Y E F A Y W G Q G T L V T V S -

Light chain

Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
izalontamab_Fv1 D I L L T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
5gz0 D I Q M T Q S P V I L S V S P G E R V S F S C R A S Q S I G T N I H W Y Q Q R T N G S P R L L I K Y A S E S I S G I P S R F S G S G S G T D F T L S I N S V E S E D I A D Y Y C Q Q N N N W P T T F G A G T K L E L K
>   Metadata
FormatBispecific Mixed mAb and scFv
IsotypeG1;na
Highest Clinical Trial (August '22)TBC
Estimated Status (August '22)Active
Recorded Developmental TechnologyTBC
INN Year Proposed2022
INN Year RecommendedNone
Companies InvolvedTBC
Conditions ApprovedTBC
Conditions ActiveTBC
Conditions DiscontinuedTBC
NotesArm 1 is highly identical to cetuximab

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy