Thera-SAbDab

REOZALIMAB

>   Structural Summary
TherapeuticReozalimab
Target 1PDCD1
Heavy Chain 1QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGLIIPSFDTAGYAQKFQGRVAITVDESTSTAYMELSSLRSEDTAVYYCARAEHSSTGTFDYWGQGTLVTVSS
Light Chain 1DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLISAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANHLPFTFGGGTKVEIK
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CD274
Heavy Chain 2QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSPDYSPYYYYGMDVWGQGTTVTVSS
Light Chain 2QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCQSYDSSLSGSVFGGGIKLTVL
100% seqID Fv 2 StructureNone
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific Whole mAb
IsotypeG1;G1
Highest Clinical Trial (August '22)TBC
Estimated Status (August '22)Active
Recorded Developmental TechnologyTBC
INN Year Proposed2022
INN Year RecommendedNone
Companies InvolvedTBC
Conditions ApprovedTBC
Conditions ActiveTBC
Conditions DiscontinuedTBC
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy