Thera-SAbDab

CIXUTUMUMAB

> Structural Summary

Therapeutic	Cixutumumab
Target	IGF1R
Heavy Chain	EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARAPLRFLEWSTQDHYYYYYMDVWGKGTTVTVSS
Light Chain	SSELTQDPAVSVALGQTVRITCQGDSLRSYYATWYQQKPGQAPILVIYGENKRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCKSRDGSGQHLVFGGGTKLTVL
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (June '19)	Phase-II
Estimated Status (June '19)	Discontinued
Recorded Developmental Technology	Dyax Human Phage Display
INN Year Proposed	2008
INN Year Recommended	2009
Companies Involved	Eli Lilly, ImClone Systems, M. D. Anderson Cancer Center, National Cancer Institute (USA)
Conditions Approved	na
Conditions Active	na
Conditions Discontinued	Breast cancer, Colorectal cancer, Head and neck cancer, Liver cancer, Neuroendocrine tumours, Non-small cell lung cancer, Oesophageal cancer, Pancreatic cancer, Prostate cancer, Rhabdomyosarcoma, Sarcoma, Soft tissue sarcoma, Solid tumours, Thymoma
Notes

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]