Thera-SAbDab

SOLITOMAB

>   Structural Summary
TherapeuticSolitomab
Target 1EPCAM
Heavy Chain 1EVQLLEQSGAELVRPGTSVKISCKASGYAFTNYWLGWVKQRPGHGLEWIGDIFPGSGNIHYNEKFKGKATLTADKSSSTAYMQLSSLTFEDSAVYFCARLRNWDEPMDYWGQGTTVTVSS
Light Chain 1ELVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEIK
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CD3E
Heavy Chain 2DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSS
Light Chain 2DIVLTQSPATLSLSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYYCQQWSSNPLTFGGGTKVEIK
100% seqID Fv 2 StructureNone
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific scFv
Isotypena;na
Highest Clinical Trial (October '21)Phase-I
Estimated Status (October '21)Discontinued
Recorded Developmental Technologyna
INN Year Proposed2011
INN Year Recommended2012
Companies InvolvedMicromet Inc, Amgen
Conditions Approvedna
Conditions Activena
Conditions DiscontinuedSolid tumours
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy