Thera-SAbDab

ENRISTOMIG

> Structural Summary

Therapeutic	Enristomig
Target 1	PDL1/CD274
Heavy Chain 1	EVQLLESGGGEVQPGGSLRLSCAASGGIFAIKPISWYRQAPGKQREWVSTTTSSGATNYAESVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCNVFEYWGQGTLVTVKP
Light Chain 1	na
100% seqID Fv 1 Structure	None
99% seqID Fv 1 Structure	None
95-98% seqID Fv 1 Structure	None
Target 2	TNFRSF9/CD137/4-1BB
Heavy Chain 2	EVQLLESGGGEVQPGGSLRLSCAASGFSFSINAMGWYRQAPGKRREFVAAIESGRNTVYAESVKGRFTISRDNAKNTVYLQMSSLRAEDTAVYYCGLLKGNRVVSPSVAYWGQGTLVTVKP
Light Chain 2	na
100% seqID Fv 2 Structure	None
99% seqID Fv 2 Structure	None
95-98% seqID Fv 2 Structure	None

There are currently no PDB structures close in sequence to either Fv of this therapeutic. Click the links to build models with ABodyBuilder: [Fv 1] [Fv 2]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder: [Fv 1] [Fv 2]
Test for possible therapeutic developability issues with TAP: [Fv 1] [Fv 2]
Assign canonical forms by sequence with SCALOP: [Fv 1] [Fv 2]
Number the sequences in any numbering scheme with ANARCI: [Fv 1 H] [Fv 1 L] [Fv 2 H] [Fv 2 L]

Format	Bispecific Single Domains (VH-VH'-G1(h-CH2-CH3) Dimer)
Isotype	G1;G1
Highest Clinical Trial (Aug '23)	TBC
Estimated Status (Aug '23)	Active
Recorded Developmental Technology
INN Year Proposed	2023
INN Year Recommended	None
Companies Involved	TBC
Conditions Approved	TBC
Conditions Active	TBC
Conditions Discontinued	TBC
Notes

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy