Therapeutic | Envafolimab |
Target | PDL1/CD274 |
Heavy Chain | QVQLVESGGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS |
Light Chain | na |
100% seqID Fv Structure | None |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
Format | Single Domain Variable Fragment;H |
Isotype | G1 |
Highest Clinical Trial (August '23) | Approved |
Estimated Status (August '23) | Active |
Recorded Developmental Technology | |
INN Year Proposed | 2018 |
INN Year Recommended | 2019 |
Companies Involved | Alphamab, 3D Medicines, Sun Yat-Sen University |
Conditions Approved | Solid tumours |
Conditions Active | Biliary cancer, Breast cancer, Gastric cancer, Gastrointestinal cancer, Hepatitis B, Malignant fibrous histiocytoma, Soft tissue sarcoma |
Conditions Discontinued | na |
Notes | Oct '22: Sequence fixed to contain the full DJ/J regions. Genetics: vicpac/homosap |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]