| Reference title | Structure of Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Site 412 to 423 in Complex with Antibody AP33 |
| Reference authors | Kong,L.;Giang,E.;Nieusma,T. et al. |
| Reference URL | https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=4g6a |
| Heavy chain | VQLLEQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTTVTVSS |
| Light chain | LTLTQSPASLAVSLGQRATISCRASESVDGYGNSFLHWFQQKPGQPPKLLIYLASNLNSGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNVDPWTFGGGTKLEIK |
| Heavy chain definition | Structure Of The Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Region 412-423 Bound To The Broadly Neutralizing Antibody Ap33 |
| Light chain definition | Structure Of The Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Region 412-423 Bound To The Broadly Neutralizing Antibody Ap33 |
| Organism | homo sapiens |
| Targets mentioned | Hepatitis; Antigenic |
| Update date | 18-JUL-2012 |
Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]
Download BibTex Reference
Header image credit: David Goodsell
