>   Entry details
Reference title Structural basis for selective inhibition of immunoglobulin E-receptor interactions by an anti-IgE antibody
Reference authors Chen,J.B.;Ramadani,F.;Pang,M.O. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=6eyo
Heavy chain QVQLQQSGAELAKPGASVMLSCKASGYTFNGYWMHWVKQRPGQDLEWIGYINPTTGHTEYNQKFKDKATLTADESSNTAYIELSSLTSDDSAVYYCARQEYRHSWFAYWGQGTLVTVSA
Light chain DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDTYMNWYHQKPGQPPKLLIYAASNLDSGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQTNEDPWTFGGGTKLEIK
Heavy chain definition Structure Of Extended Ige-Fc In Complex With Two Anti-Ige Fabs
Light chain definition Structure Of Extended Ige-Fc In Complex With Two Anti-Ige Fabs
Organism homo sapiens
Targets mentioned Ige; IgE
Update date 13-NOV-2017
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell