>   Entry details
Reference title CD40/anti-CD40 antibody complexes which illustrate agonist and antagonist structural switches
Reference authors Argiriadi,M.A.;Benatuil,L.;Dubrovska,I. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=6pe8
Heavy chain EVQLVESGGGLVKPGGSLRLSCAASGFTFSDYGMNWVRQAPGKGLEWIAYISSGRGNIYYADTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSWGYFDVWGQGTTVTVSS
Light chain DIVMTQSPDSLAVSLGERATINCKSSQSLLNRGNQKNYLTWFQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYTYPLTFGQGTKLEIK
Heavy chain definition Crystal Structure Of Cd40/Abbv-323 Fab Complex
Light chain definition Crystal Structure Of Cd40/Abbv-323 Fab Complex
Organism homo sapiens
Targets mentioned TNFRSF5; p50; Bp50; CD40
Update date 20-JUN-2019
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell