>   Entry details
Reference title Insertion of atypical glycans into the tumor antigen-binding site identifies DLBCLs with distinct origin and behavior
Reference authors Chiodin,G.;Allen,J.D.;Bryant,D.J. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=6zec
Heavy chain QVQLQQWGAGLLKTSETLSLTCAVYGGSFNNYNWTWIRQPPGKGLEWIGQINHSGTTNYNPSLKSRVTMSIDPSENQFSLKVRSVTAADTAIYYCVRGSPESSGNYWGHFQYWGQGTLATVSS
Light chain DIVMTQSPDSLSVSLGERATINCKSSQSVLYSSHNKNYLAWYQQKPGQPPRLLIYWASTRESGVPDRFSGSGSGTDFTLTINTLQAEDVAVYYCQQYYTTPYTFGQGTKLEIK
Heavy chain definition Crystal Structure Of The Fab Fragment Of A Glycosylated Lymphoma Antibody
Light chain definition Crystal Structure Of The Fab Fragment Of A Glycosylated Lymphoma Antibody
Organism homo sapiens
Targets mentioned unidentified
Update date 16-JUN-2020
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell