>   Entry details
Reference title Ternary Complex Cr3022 H11-H4 And Rbd (Sars-Cov-2)
Reference authors Naismith, J.H., Mikolajek, H., Le Bas, A.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=6zh9
Heavy chain QMQLVQSGTEVKKPGESLKISCKGSGYGFITYWIGWVRQMPGKGLEWMGIIYPGDSETRYSPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCAGGSGISTPMDVWGQGTTVTVAS
Light chain DIQLTQSPDSLAVSLGERATINCKSSQSVLYSSINKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKVEIK
Heavy chain definition Ternary Complex Cr3022 H11-H4 And Rbd (Sars-Cov-2)
Light chain definition Ternary Complex Cr3022 H11-H4 And Rbd (Sars-Cov-2)
Organism homo sapiens; severe acute respiratory syndrome coronavirus 2; lama glama
Targets mentioned H11; CMT2L; HSPB8; HSP22; E2IG1
Update date 21-JUN-2020
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell