>   Entry details
Reference title A broadly protective antibody that targets the flavivirus NS1 protein
Reference authors Modhiran,N.;Song,H.;Liu,L. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7bsc
Heavy chain EVKLQESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGRSNYNPSLKNRISITRDTSKNQFFLKLNFVTTEDTATYYCASFYYYTSRPLVYWGQGTLLTVSS
Light chain EIVLTQSPASLAVSLGQRATISCRASESVEYSGTSLMHWYQQKPGQPPKLLIYAASNVESGVPARFSGSGSGTDFSLNIHPVEEDDIAMYFCQQSRKVPYTFGGGTKLELK
Heavy chain definition Complex Structure Of 1G5.3 Fab Bound To Denv2 Ns1C
Light chain definition Complex Structure Of 1G5.3 Fab Bound To Denv2 Ns1C
Organism homo sapiens
Targets mentioned SHP2; PTPN11; BPTP3; SH-PTP2; NS1; PTP2C; SHP-2
Update date 30-MAR-2020
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell