>   Entry details
Reference title Structural Characterization of a Minimal Antibody against Human APOBEC3B
Reference authors Tang,H.;Demir,O.;Kurniawan,F. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7km6
Heavy chain EVQLLESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARGGEGYYFDYWGQGTTLTVSS
Light chain DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYSYPYTFGGGTKLEIK
Heavy chain definition Apobec3B Antibody 5G7 Fv-Clasp
Light chain definition Apobec3B Antibody 5G7 Fv-Clasp
Organism homo sapiens
Targets mentioned PHRBNL; FLJ21201; APOBEC3B
Update date 02-NOV-2020
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell