| Reference title | Development, structure and function of potent monospecific and bispecific monoclonal antibodies that neutralize SARS-CoV-2 and its mutant variant |
| Reference authors | Hu,Y.;Xiong,Y. |
| Reference URL | https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7mw3 |
| Heavy chain | QVQLQQSAAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPTSGYTEYNQNFKDKTTLTADKSSSTAYMQLNSLTSEDSAVYYCAREGHRVGPAYWGQGTLVTVSA |
| Light chain | DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQTPGQPPKLLIYGSSNQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVPYTFGGGTKLEIK |
| Heavy chain definition | Structure Of The Sars-Cov-2 Spike Trimer With Two Rbds Down In Complex With The Fab Fragment Of Human Neutralizing Antibody Clone 6 |
| Light chain definition | Structure Of The Sars-Cov-2 Spike Trimer With Two Rbds Down In Complex With The Fab Fragment Of Human Neutralizing Antibody Clone 6 |
| Organism | homo sapiens |
| Targets mentioned | SARS-CoV-2 |
| Update date | 15-MAY-2021 |
Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]
Download BibTex Reference
Header image credit: David Goodsell