>   Entry details
Reference title Potent antibodies against SARS-CoV-2 isolated from a patient
Reference authors Fernandez,I.;Rey,F.A.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7qez
Heavy chain QMQLVQSGTEVKKPGESLKISCKGSGYGFITYWIGWVRQMPGKGLEWMGIIYPGDSETRYSPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCAGGSGISTPMDVWGQGTTVTVSS
Light chain DIQLTQSPDSLAVSLGERATINCKSSQSVLYSSINKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKVEIK
Heavy chain definition Crystal Structure Of The Sars-Cov-2 Rbd In Complex With The Ultrapotent Antibody Cv2.1169 And Cr3022
Light chain definition Crystal Structure Of The Sars-Cov-2 Rbd In Complex With The Ultrapotent Antibody Cv2.1169 And Cr3022
Organism homo sapiens
Targets mentioned CRIM3; SARS-CoV-2; Cv2; BMPER
Update date 03-DEC-2021
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell