>   Entry details
Reference title Structural basis for potent antibody neutralization of SARS-CoV-2 variants including B.1.1.529
Reference authors Zhou,T.;Wang,L.;Misasi,J. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7tca
Heavy chain QVQLVESGGGVVQPGRSLRLSCAASGFTLSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYVDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWAYWELLPDYYYGMDVWGQGTTVTVSS
Light chain QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTAYFPSWYQQTPGQAPRTLIYGTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGRGIVVFGGGTKLTVL
Heavy chain definition Cryo-Em Structure Of Sars-Cov-2 Omicron Spike In Complex With Antibody A19-46.1
Light chain definition Cryo-Em Structure Of Sars-Cov-2 Omicron Spike In Complex With Antibody A19-46.1
Organism homo sapiens
Targets mentioned SARS-CoV-2
Update date 23-DEC-2021
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell