| Reference title | A potent and broad neutralization of SARS-CoV-2 variants of concern by DARPins |
| Reference authors | Chonira,V.;Kwon,Y.D.;Gorman,J. et al. |
| Reference URL | https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8dw2 |
| Heavy chain | QMQLVQSGTEVKKPGESLKISCKGSGYGFITYWIGWVRQMPGKGLEWMGIIYPGDSETRYSPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCAGGSGISTPMDVWGQGTTVTVAS |
| Light chain | DIQLTQSPDSLAVSLGERATINCKSSQSVLYSSINKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKVEIK |
| Heavy chain definition | Cryo-Em Structure Of Sars-Cov-2 Rbd In Complex With Anti-Sars-Cov-2 Darpin,Sr22, And Two Antibody Fabs, S309 And Cr3022 |
| Light chain definition | Cryo-Em Structure Of Sars-Cov-2 Rbd In Complex With Anti-Sars-Cov-2 Darpin,Sr22, And Two Antibody Fabs, S309 And Cr3022 |
| Organism | homo sapiens |
| Targets mentioned | SARS-CoV-2 |
| Update date | 07-DEC-2022 |
Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]
Download BibTex Reference
Header image credit: David Goodsell
