>   Entry details
Reference title Structural delineation and computational design of SARS-CoV-2-neutralizing antibodies against Omicron subvariants
Reference authors Moriyama,S.;Anraku,Y.;Taminishi,S. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8hes
Heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFTFYSYWMTWVRQAPGKGLEWVANIKHDESESHYVDSVRGRFTISRDNAKNSVYLQMKGLRAEDTAVYYCARDGGYNILTAYYHAPSYWGQGTLVTVSS
Light chain QSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYRQYPGKAPQLMIYDVSRRPSGDSDRFSGSKSGNTASLTISGLQAEDEAEYHCSSYTGRSPYVVFGGGTKVTVL
Heavy chain definition Crystal Structure Of Sars-Cov-2 Rbd And Niv-10 Complex
Light chain definition Crystal Structure Of Sars-Cov-2 Rbd And Niv-10 Complex
Organism homo sapiens
Targets mentioned SARS-CoV-2
Update date 08-NOV-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell