>   Entry details
Reference title Development of a 1:1-binding biparatopic anti-TNFR2 antagonist by reducing signaling activity through epitope selection
Reference authors Akiba,H.;Fujita,J.;Ise,T. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8hlb
Heavy chain QVQLKESGPGLVAPSQSLSITCTVSGFSLTVYGVNWVRQPPGKGLEWLGMIWGDGSTAYNSALKSRLTITKDNSKTQVFLKMNSLQTDDTARYYCARDGRRYALDYWGQGTSVTVSS
Light chain DIVLTQSPTSLAVSLGQRATISCRASESVDSYGDSFLHWYQQKPGQPPILLIYRASNLDSGIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPYTFGGGTKLEIK
Heavy chain definition Cryo-Em Structure Of Biparatopic Antibody Bp109-92 In Complex With Tnfr2
Light chain definition Cryo-Em Structure Of Biparatopic Antibody Bp109-92 In Complex With Tnfr2
Organism homo sapiens
Targets mentioned TNFRSF1B; TNF-R-II; p75; TNFR80; TNFR2; TNFBR; TNF-R75; CD120b
Update date 04-OCT-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell