>   Entry details
Reference title FTL004, an anti-CD38 mAb with negligible RBC binding and enhanced pro-apoptotic activity, is a novel candidate for treatments of multiple myeloma and non-Hodgkin lymphoma
Reference authors Zhang,G.;Guo,C.;Wang,Y. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8il3
Heavy chain QVQLVQSGSELKKPGASVKVSCKASGYTFTDYNVHWIRQAPGQGLEWIGYFYPRNGATHYNQKFTGRAVLSADTSVSTAYLQISSLKAEDTAVYFCARGETPGTFPYWGQGTLVTVSS
Light chain DIVLTQSPASLAVSPGQRATITCRASESVDNFGITFMHWYQQKPGQPPKLLIYRASNLESGVPARFSGSGSRTDFTLTINPVEANDTANYYCQQSSKDPRTFGQGTKLEIK
Heavy chain definition Cryo-Em Structure Of Cd38 In Complex With Ftl004
Light chain definition Cryo-Em Structure Of Cd38 In Complex With Ftl004
Organism homo sapiens
Targets mentioned apoptotic; cADPR1; CD38
Update date 29-MAR-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell