>   Entry details
Reference title Structure of XBB spike protein (S) in complex with monoclonal antibody 6I18 at 3.30 Angstroms resolution
Reference authors Mao,Q.;Hao,A.;Chen,Z. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8jio
Heavy chain QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWTWIRQPPGKGLEWIGYIYYTGSTNYNPSLKSRVTISVDTSKSQFSLKLSSVTAADTAVYYCATDYYDSSGYSYGMDVWGHGTTVTVSS
Light chain DIQMTQSPSSVSASVGDRVTITCRASQGISGWLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANNFPRTFGQGTKVEIK
Heavy chain definition Xbb Spike Protein (S) In Complex With Monoclonal Antibody 6I18
Light chain definition Xbb Spike Protein (S) In Complex With Monoclonal Antibody 6I18
Organism homo sapiens
Targets mentioned unidentified
Update date 29-MAY-2024
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell