>   Entry details
Reference title Integrating artificial intelligence-based epitope prediction in a SARS-CoV-2 antibody discovery pipeline: caution is warranted
Reference authors Acar,D.D.;Witkowski,W.;Wejda,M. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8qpr
Heavy chain QVQLVQSGAEVKKPGASVKVSCRASGYTFTGYYIHWVRQAPGQGLEWMGWSSPISGATNYTQKFQGRVTLTTDTSINTAYMELSRLRPDDTAVYYCARDIAFAIVTGSLDPWGQGTLVTVSS
Light chain QSVLTQPPSASGSPGQSVTISCTGTSNDVGGYNYVSWYQHHPGKAPKLMIYEVTKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCNSYAGSNNWVFGGGTKLTVL
Heavy chain definition Sars-Cov-2 S Protein Bound To Human Neutralising Antibody Uzgent_G5
Light chain definition Sars-Cov-2 S Protein Bound To Human Neutralising Antibody Uzgent_G5
Organism homo sapiens
Targets mentioned SARS-CoV-2
Update date 31-JAN-2024
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell