>   Entry details
Reference title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination
Reference authors Bailey,L.J.;Sheehy,K.M.;Dominik,P.K. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8t7f
Heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFDSGAYLRHWVRQAPGKGLEWVASIYPSYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSAASYYGYWHWYHFSPGMDYWGQGTLVTVSS
Light chain DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYVSGGWLITFGQGTKVEIK
Heavy chain definition Structure Of The S1 Variant Of Fab F1
Light chain definition Structure Of The S1 Variant Of Fab F1
Organism homo sapiens
Targets mentioned unidentified
Update date 22-NOV-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell