>   Entry details
Reference title Locking the Elbow: Improved Antibody Fab Fragments as Chaperones for Structure Determination
Reference authors Bailey,L.J.;Sheehy,K.M.;Dominik,P.K. et al.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8t7i
Heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFDSGAYLRHWVRQAPGKGLEWVASIYPSYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSAASYYGYWHWYHFSPGMDYWGQGTLVTVFN
Light chain DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYVSGGWLITFGQGTKVEIK
Heavy chain definition Structure Of The S1Ce Variant Of Fab F1 (Fabs1Ce-F1)
Light chain definition Structure Of The S1Ce Variant Of Fab F1 (Fabs1Ce-F1)
Organism homo sapiens
Targets mentioned unidentified
Update date 22-NOV-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder

Display options:




Color options:








>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell