| Reference title | IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains |
| Reference authors | Lefranc,M.P.;Pommié,C. et al. |
| Reference URL | https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=8t9b |
| Heavy chain | EVQLVESGGGLVQPGGSLRLSCAASGFDSGAYLRHWVRQAPGKGLEWVASIYPSYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSAASYYGYWHWYHFSPGMDYWGQGTLVTVSS |
| Light chain | DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYVSGGWLITFGQGTKVEIK |
| Heavy chain definition | Structure Of The Ck Variant Of Fab F1 (Fabc-F1) In Complex With The C-Terminal Fn3 Domain Of Epha2 |
| Light chain definition | Structure Of The Ck Variant Of Fab F1 (Fabc-F1) In Complex With The C-Terminal Fn3 Domain Of Epha2 |
| Organism | homo sapiens |
| Targets mentioned | unidentified |
| Update date | 01-MAY-2024 |
Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]
Download BibTex Reference
Header image credit: David Goodsell
