>   Entry details
Reference title Discovery of ultrapotent broadly neutralizing antibodies from SARS-CoV-2 elite neutralizers
Reference authors Vanshylla,K.; Fan,C.; Wunsch,M. et al.
Reference URL https://www.ncbi.nlm.nih.gov/protein/UIK23908
Heavy chain EVQLVQSGAEVKKPGESLKISCTGSGYSFTTYWIGWVRQMPGKGLEWMGVIYPGDSDTRYSPSFQGQVTFSADKSISTAYLQWSSLKASDTAIYYCARHGNRYSSGWYQPTGVDVWGQGTTVTVSS
Light chain QTVVIQEPSFSVSPGGTVTLTCGLSSGSVSSNYYPTWYKQTPGQAPSTLIYTTNTRSSGVPDRFSGSILGNKAALTITGAQADDECEYHCALYMGSGIWVFGGGTKLTVL
Heavy chain definition immunoglobulin heavy chain variable region, partial [Homo sapiens]
Light chain definition immunoglobulin lambda light chain variable region, partial [Homo sapiens]
Organism homo sapiens
Targets mentioned SARS-CoV-2
Update date 13-JAN-2022
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell