>   Entry details
Reference title Protective human antibodies against a conserved epitope in pre- and postfusion influenza hemagglutinin
Reference authors Finney,J.; Moseman,A.P.; Kong,S. et al.
Reference URL https://www.ncbi.nlm.nih.gov/protein/WNZ34107
Heavy chain QVQLVQSGAELKKPGASVKVSCKASGYTFTGNYIHWMRQVPGQGLEWMGWINPRTGDTHHAQKFQGRVDMTRDTSINTAYLELTRLESDDTALYYCARCVFATSQFDPWGQGTLVTVSS
Light chain QSALTQPASVSGSPGQSITISCTGTNSDIGSHNLVSWYQQHPGKAPKVMIYDDSKRPSGVSNRFSGSKSGSTASLTISGLQSEDEADYYCCSYAGSSNWVFGGGTKLTLL
Heavy chain definition immunoglobulin heavy chain variable region, partial [Homo sapiens]
Light chain definition immunoglobulin light chain variable region, partial [Homo sapiens]
Organism homo sapiens
Targets mentioned hemagglutinin
Update date 17-OCT-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell