----------------------------------------------------------------------------------------------------
__/\\\\\\\\\\\\\\___/\\\\\\\\____/\\\\\\\\\\____
_\///////\\/////__/\\\\\\\\\\\__\//////////\\___
_______\/\\______/\\/////////\\_\/\\_____\/\\___
_______\/\\_____\/\\_______\/\\_\/\\\\\\\\\/____
_______\/\\_____\/\\\\\\\\\\/\\_\/////////______
_______\/\\_____\/\\/////////\\_\/\\____________
_______\/\\_____\/\\_______\/\\_\/\\____________
_______\/\\_____\/\\_______\/\\_\/\\____________
_______\///_____\///_______\///_\///____________
THE THERAPEUTIC ANTIBODY PROFILER
Software developed in the Oxford Protein Informatics Group, Department of Statistics, University of Oxford
Matthew I. J. Raybould (Oxford), Claire Marks (Oxford), Konrad Krawczyk (Oxford), Bruck Taddese (AstraZeneca), Jaroslaw Nowak (Oxford), Alan P. Lewis (GSK), Alexander Bujotzek (Roche), Jiye Shi (UCB), Charlotte M. Deane (Oxford)
If you are using this resource for a publication, please cite the following paper:
Raybould, M.I.J., Marks, C., Krawczyk, K., Taddese, B., Nowak, J., Lewis, A.P., Bujotzek, A., Shi, J. & Deane, C.M. (2019) Five Computational Developability Guidelines for Therapeutic Antibody Profiling Proceedings of the National Academy of Sciences USA, 116(10):4025-4030
Example usage: TAP -s QVKLQESGAELARPGASVKLSCKASGYTFTNYWMQWVKQRPGQGLDWIGAIYPGDGNTRYTHKFKGKATLTADKSSSTAYMQLSSLASEDSGVYYCARGEGNYAWFAYWGQGTTVTVSS/DIELTQSPASLSASVGETVTITCQASENIYSYLAWHQQKQGKSPQLLVYNAKTLAGGVSSRFSGSGSGTHFSLKIKSLQPEDFGIYYCQHHYGILPTFGGGTKLEIK --output TAP_example_output
----------------------------------------------------------------------------------------------------
The hydrophobicity scale is set to Kyte & Doolittle
You have chosen the single sequence option.
Sequence name is: Fv1
Heavy chain is: EVQLVQSGGGLVKPGGSLRLSCAASGFTFSGYTMNWVRQAPGKGLEWVSGISGNSGIIEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDILGGFYYFDYWGQGTPVTVSS
Light chain is: VLTQSPLSLPVTLGQPASISCRSSQSLVFSDGNTYLHWFQQRPGQPPRRLIYQVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQVHSTFGPGTTVDIK
----------------------------------------------------------------------------------------------------
TAP is running on sequence Fv1
Analysing CDRs and amino acid compositions...
The Heavy Chain is analysed as follows:
REGION DICTIONARY
{'imgt': {'cdrh3': 'AKDILGGFYYFDY', 'fwh1': 'EVQLVQSGGGLVKPGGSLRLSCAAS', 'cdrh1': 'GFTFSGYT', 'fwh2': 'MNWVRQAPGKGLEWVSG', 'cdrh2': 'ISGNSGII', 'fwh3': 'EYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYC', 'fwh4': 'WGQGTPVTVSS'}, 'north': {'cdrh3': 'AKDILGGFYYFDY', 'fwh1': 'EVQLVQSGGGLVKPGGSLRLSC', 'cdrh1': 'AASGFTFSGYTMN', 'fwh2': 'WVRQAPGKGLEWVS', 'cdrh2': 'GISGNSGIIE', 'fwh3': 'YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYC', 'fwh4': 'WGQGTPVTVSS'}, 'chothia': {'cdrh3': 'DILGGFYYFDY', 'fwh1': 'EVQLVQSGGGLVKPGGSLRLSCAAS', 'cdrh1': 'GFTFSGY', 'fwh2': 'TMNWVRQAPGKGLEWVSGI', 'cdrh2': 'SGNSGI', 'fwh3': 'IEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAK', 'fwh4': 'WGQGTPVTVSS'}, 'kabat': {'cdrh3': 'DILGGFYYFDY', 'fwh1': 'EVQLVQSGGGLVKPGGSLRLSCAASGFTFS', 'cdrh1': 'GYTMN', 'fwh2': 'WVRQAPGKGLEWVS', 'cdrh2': 'GISGNSGIIEYADSVKG', 'fwh3': 'RFTISRDNSKNTLYLQMNSLRAEDTALYYCAK', 'fwh4': 'WGQGTPVTVSS'}}
AA BY POSIION DICTIONARY
{'imgt': {'cdrh3': {'105': 'A', '106': 'K', '107': 'D', '108': 'I', '109': 'L', '110': 'G', '111': 'G', '112': 'F', '113': 'Y', '114': 'Y', '115': 'F', '116': 'D', '117': 'Y'}, 'fwh1': {'1': 'E', '2': 'V', '3': 'Q', '4': 'L', '5': 'V', '6': 'Q', '7': 'S', '8': 'G', '9': 'G', '11': 'G', '12': 'L', '13': 'V', '14': 'K', '15': 'P', '16': 'G', '17': 'G', '18': 'S', '19': 'L', '20': 'R', '21': 'L', '22': 'S', '23': 'C', '24': 'A', '25': 'A', '26': 'S'}, 'cdrh1': {'27': 'G', '28': 'F', '29': 'T', '30': 'F', '35': 'S', '36': 'G', '37': 'Y', '38': 'T'}, 'fwh2': {'39': 'M', '40': 'N', '41': 'W', '42': 'V', '43': 'R', '44': 'Q', '45': 'A', '46': 'P', '47': 'G', '48': 'K', '49': 'G', '50': 'L', '51': 'E', '52': 'W', '53': 'V', '54': 'S', '55': 'G'}, 'cdrh2': {'56': 'I', '57': 'S', '58': 'G', '59': 'N', '62': 'S', '63': 'G', '64': 'I', '65': 'I'}, 'fwh3': {'66': 'E', '67': 'Y', '68': 'A', '69': 'D', '70': 'S', '71': 'V', '72': 'K', '74': 'G', '75': 'R', '76': 'F', '77': 'T', '78': 'I', '79': 'S', '80': 'R', '81': 'D', '82': 'N', '83': 'S', '84': 'K', '85': 'N', '86': 'T', '87': 'L', '88': 'Y', '89': 'L', '90': 'Q', '91': 'M', '92': 'N', '93': 'S', '94': 'L', '95': 'R', '96': 'A', '97': 'E', '98': 'D', '99': 'T', '100': 'A', '101': 'L', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwh4': {'118': 'W', '119': 'G', '120': 'Q', '121': 'G', '122': 'T', '123': 'P', '124': 'V', '125': 'T', '126': 'V', '127': 'S', '128': 'S'}}, 'north': {'cdrh3': {'105': 'A', '106': 'K', '107': 'D', '108': 'I', '109': 'L', '110': 'G', '111': 'G', '112': 'F', '113': 'Y', '114': 'Y', '115': 'F', '116': 'D', '117': 'Y'}, 'fwh1': {'1': 'E', '2': 'V', '3': 'Q', '4': 'L', '5': 'V', '6': 'Q', '7': 'S', '8': 'G', '9': 'G', '11': 'G', '12': 'L', '13': 'V', '14': 'K', '15': 'P', '16': 'G', '17': 'G', '18': 'S', '19': 'L', '20': 'R', '21': 'L', '22': 'S', '23': 'C'}, 'cdrh1': {'24': 'A', '25': 'A', '26': 'S', '27': 'G', '28': 'F', '29': 'T', '30': 'F', '35': 'S', '36': 'G', '37': 'Y', '38': 'T', '39': 'M', '40': 'N'}, 'fwh2': {'41': 'W', '42': 'V', '43': 'R', '44': 'Q', '45': 'A', '46': 'P', '47': 'G', '48': 'K', '49': 'G', '50': 'L', '51': 'E', '52': 'W', '53': 'V', '54': 'S'}, 'cdrh2': {'55': 'G', '56': 'I', '57': 'S', '58': 'G', '59': 'N', '62': 'S', '63': 'G', '64': 'I', '65': 'I', '66': 'E'}, 'fwh3': {'67': 'Y', '68': 'A', '69': 'D', '70': 'S', '71': 'V', '72': 'K', '74': 'G', '75': 'R', '76': 'F', '77': 'T', '78': 'I', '79': 'S', '80': 'R', '81': 'D', '82': 'N', '83': 'S', '84': 'K', '85': 'N', '86': 'T', '87': 'L', '88': 'Y', '89': 'L', '90': 'Q', '91': 'M', '92': 'N', '93': 'S', '94': 'L', '95': 'R', '96': 'A', '97': 'E', '98': 'D', '99': 'T', '100': 'A', '101': 'L', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwh4': {'118': 'W', '119': 'G', '120': 'Q', '121': 'G', '122': 'T', '123': 'P', '124': 'V', '125': 'T', '126': 'V', '127': 'S', '128': 'S'}}, 'chothia': {'cdrh3': {'107': 'D', '108': 'I', '109': 'L', '110': 'G', '111': 'G', '112': 'F', '113': 'Y', '114': 'Y', '115': 'F', '116': 'D', '117': 'Y'}, 'fwh1': {'1': 'E', '2': 'V', '3': 'Q', '4': 'L', '5': 'V', '6': 'Q', '7': 'S', '8': 'G', '9': 'G', '11': 'G', '12': 'L', '13': 'V', '14': 'K', '15': 'P', '16': 'G', '17': 'G', '18': 'S', '19': 'L', '20': 'R', '21': 'L', '22': 'S', '23': 'C', '24': 'A', '25': 'A', '26': 'S'}, 'cdrh1': {'27': 'G', '28': 'F', '29': 'T', '30': 'F', '35': 'S', '36': 'G', '37': 'Y'}, 'fwh2': {'38': 'T', '39': 'M', '40': 'N', '41': 'W', '42': 'V', '43': 'R', '44': 'Q', '45': 'A', '46': 'P', '47': 'G', '48': 'K', '49': 'G', '50': 'L', '51': 'E', '52': 'W', '53': 'V', '54': 'S', '55': 'G', '56': 'I'}, 'cdrh2': {'57': 'S', '58': 'G', '59': 'N', '62': 'S', '63': 'G', '64': 'I'}, 'fwh3': {'65': 'I', '66': 'E', '67': 'Y', '68': 'A', '69': 'D', '70': 'S', '71': 'V', '72': 'K', '74': 'G', '75': 'R', '76': 'F', '77': 'T', '78': 'I', '79': 'S', '80': 'R', '81': 'D', '82': 'N', '83': 'S', '84': 'K', '85': 'N', '86': 'T', '87': 'L', '88': 'Y', '89': 'L', '90': 'Q', '91': 'M', '92': 'N', '93': 'S', '94': 'L', '95': 'R', '96': 'A', '97': 'E', '98': 'D', '99': 'T', '100': 'A', '101': 'L', '102': 'Y', '103': 'Y', '104': 'C', '105': 'A', '106': 'K'}, 'fwh4': {'118': 'W', '119': 'G', '120': 'Q', '121': 'G', '122': 'T', '123': 'P', '124': 'V', '125': 'T', '126': 'V', '127': 'S', '128': 'S'}}, 'kabat': {'cdrh3': {'107': 'D', '108': 'I', '109': 'L', '110': 'G', '111': 'G', '112': 'F', '113': 'Y', '114': 'Y', '115': 'F', '116': 'D', '117': 'Y'}, 'fwh1': {'1': 'E', '2': 'V', '3': 'Q', '4': 'L', '5': 'V', '6': 'Q', '7': 'S', '8': 'G', '9': 'G', '11': 'G', '12': 'L', '13': 'V', '14': 'K', '15': 'P', '16': 'G', '17': 'G', '18': 'S', '19': 'L', '20': 'R', '21': 'L', '22': 'S', '23': 'C', '24': 'A', '25': 'A', '26': 'S', '27': 'G', '28': 'F', '29': 'T', '30': 'F', '35': 'S'}, 'cdrh1': {'36': 'G', '37': 'Y', '38': 'T', '39': 'M', '40': 'N'}, 'fwh2': {'41': 'W', '42': 'V', '43': 'R', '44': 'Q', '45': 'A', '46': 'P', '47': 'G', '48': 'K', '49': 'G', '50': 'L', '51': 'E', '52': 'W', '53': 'V', '54': 'S'}, 'cdrh2': {'55': 'G', '56': 'I', '57': 'S', '58': 'G', '59': 'N', '62': 'S', '63': 'G', '64': 'I', '65': 'I', '66': 'E', '67': 'Y', '68': 'A', '69': 'D', '70': 'S', '71': 'V', '72': 'K', '74': 'G'}, 'fwh3': {'75': 'R', '76': 'F', '77': 'T', '78': 'I', '79': 'S', '80': 'R', '81': 'D', '82': 'N', '83': 'S', '84': 'K', '85': 'N', '86': 'T', '87': 'L', '88': 'Y', '89': 'L', '90': 'Q', '91': 'M', '92': 'N', '93': 'S', '94': 'L', '95': 'R', '96': 'A', '97': 'E', '98': 'D', '99': 'T', '100': 'A', '101': 'L', '102': 'Y', '103': 'Y', '104': 'C', '105': 'A', '106': 'K'}, 'fwh4': {'118': 'W', '119': 'G', '120': 'Q', '121': 'G', '122': 'T', '123': 'P', '124': 'V', '125': 'T', '126': 'V', '127': 'S', '128': 'S'}}}
[((1, ' '), 'E'), ((2, ' '), 'V'), ((3, ' '), 'Q'), ((4, ' '), 'L'), ((5, ' '), 'V'), ((6, ' '), 'Q'), ((7, ' '), 'S'), ((8, ' '), 'G'), ((9, ' '), 'G'), ((10, ' '), '-'), ((11, ' '), 'G'), ((12, ' '), 'L'), ((13, ' '), 'V'), ((14, ' '), 'K'), ((15, ' '), 'P'), ((16, ' '), 'G'), ((17, ' '), 'G'), ((18, ' '), 'S'), ((19, ' '), 'L'), ((20, ' '), 'R'), ((21, ' '), 'L'), ((22, ' '), 'S'), ((23, ' '), 'C'), ((24, ' '), 'A'), ((25, ' '), 'A'), ((26, ' '), 'S'), ((27, ' '), 'G'), ((28, ' '), 'F'), ((29, ' '), 'T'), ((30, ' '), 'F'), ((31, ' '), '-'), ((32, ' '), '-'), ((33, ' '), '-'), ((34, ' '), '-'), ((35, ' '), 'S'), ((36, ' '), 'G'), ((37, ' '), 'Y'), ((38, ' '), 'T'), ((39, ' '), 'M'), ((40, ' '), 'N'), ((41, ' '), 'W'), ((42, ' '), 'V'), ((43, ' '), 'R'), ((44, ' '), 'Q'), ((45, ' '), 'A'), ((46, ' '), 'P'), ((47, ' '), 'G'), ((48, ' '), 'K'), ((49, ' '), 'G'), ((50, ' '), 'L'), ((51, ' '), 'E'), ((52, ' '), 'W'), ((53, ' '), 'V'), ((54, ' '), 'S'), ((55, ' '), 'G'), ((56, ' '), 'I'), ((57, ' '), 'S'), ((58, ' '), 'G'), ((59, ' '), 'N'), ((60, ' '), '-'), ((61, ' '), '-'), ((62, ' '), 'S'), ((63, ' '), 'G'), ((64, ' '), 'I'), ((65, ' '), 'I'), ((66, ' '), 'E'), ((67, ' '), 'Y'), ((68, ' '), 'A'), ((69, ' '), 'D'), ((70, ' '), 'S'), ((71, ' '), 'V'), ((72, ' '), 'K'), ((73, ' '), '-'), ((74, ' '), 'G'), ((75, ' '), 'R'), ((76, ' '), 'F'), ((77, ' '), 'T'), ((78, ' '), 'I'), ((79, ' '), 'S'), ((80, ' '), 'R'), ((81, ' '), 'D'), ((82, ' '), 'N'), ((83, ' '), 'S'), ((84, ' '), 'K'), ((85, ' '), 'N'), ((86, ' '), 'T'), ((87, ' '), 'L'), ((88, ' '), 'Y'), ((89, ' '), 'L'), ((90, ' '), 'Q'), ((91, ' '), 'M'), ((92, ' '), 'N'), ((93, ' '), 'S'), ((94, ' '), 'L'), ((95, ' '), 'R'), ((96, ' '), 'A'), ((97, ' '), 'E'), ((98, ' '), 'D'), ((99, ' '), 'T'), ((100, ' '), 'A'), ((101, ' '), 'L'), ((102, ' '), 'Y'), ((103, ' '), 'Y'), ((104, ' '), 'C'), ((105, ' '), 'A'), ((106, ' '), 'K'), ((107, ' '), 'D'), ((108, ' '), 'I'), ((109, ' '), 'L'), ((110, ' '), 'G'), ((111, ' '), 'G'), ((112, ' '), 'F'), ((113, ' '), 'Y'), ((114, ' '), 'Y'), ((115, ' '), 'F'), ((116, ' '), 'D'), ((117, ' '), 'Y'), ((118, ' '), 'W'), ((119, ' '), 'G'), ((120, ' '), 'Q'), ((121, ' '), 'G'), ((122, ' '), 'T'), ((123, ' '), 'P'), ((124, ' '), 'V'), ((125, ' '), 'T'), ((126, ' '), 'V'), ((127, ' '), 'S'), ((128, ' '), 'S')]
The Light Chain is analysed as follows:
REGION DICTIONARY
{'imgt': {'cdrl3': 'MQALQVHST', 'fwl1': 'VLTQSPLSLPVTLGQPASISCRSS', 'cdrl1': 'QSLVFSDGNTY', 'fwl2': 'LHWFQQRPGQPPRRLIY', 'cdrl2': 'QVS', 'fwl3': 'NRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC', 'fwl4': 'FGPGTTVDIK'}, 'north': {'cdrl3': 'MQALQVHST', 'fwl1': 'VLTQSPLSLPVTLGQPASISC', 'cdrl1': 'RSSQSLVFSDGNTYLH', 'fwl2': 'WFQQRPGQPPRRLI', 'cdrl2': 'YQVSNRDS', 'fwl3': 'GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC', 'fwl4': 'FGPGTTVDIK'}, 'chothia': {'cdrl3': 'MQALQVHST', 'fwl1': 'VLTQSPLSLPVTLGQPASISC', 'cdrl1': 'RSSQSLVFSDGNTYLH', 'fwl2': 'WFQQRPGQPPRRLIY', 'cdrl2': 'QVSNRDS', 'fwl3': 'GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC', 'fwl4': 'FGPGTTVDIK'}, 'kabat': {'cdrl3': 'MQALQVHST', 'fwl1': 'VLTQSPLSLPVTLGQPASISC', 'cdrl1': 'RSSQSLVFSDGNTYLH', 'fwl2': 'WFQQRPGQPPRRLIY', 'cdrl2': 'QVSNRDS', 'fwl3': 'GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC', 'fwl4': 'FGPGTTVDIK'}}
AA BY POSIION DICTIONARY
{'imgt': {'cdrl3': {'105': 'M', '106': 'Q', '107': 'A', '108': 'L', '109': 'Q', '114': 'V', '115': 'H', '116': 'S', '117': 'T'}, 'fwl1': {'3': 'V', '4': 'L', '5': 'T', '6': 'Q', '7': 'S', '8': 'P', '9': 'L', '10': 'S', '11': 'L', '12': 'P', '13': 'V', '14': 'T', '15': 'L', '16': 'G', '17': 'Q', '18': 'P', '19': 'A', '20': 'S', '21': 'I', '22': 'S', '23': 'C', '24': 'R', '25': 'S', '26': 'S'}, 'cdrl1': {'27': 'Q', '28': 'S', '29': 'L', '30': 'V', '31': 'F', '32': 'S', '34': 'D', '35': 'G', '36': 'N', '37': 'T', '38': 'Y'}, 'fwl2': {'39': 'L', '40': 'H', '41': 'W', '42': 'F', '43': 'Q', '44': 'Q', '45': 'R', '46': 'P', '47': 'G', '48': 'Q', '49': 'P', '50': 'P', '51': 'R', '52': 'R', '53': 'L', '54': 'I', '55': 'Y'}, 'cdrl2': {'56': 'Q', '57': 'V', '65': 'S'}, 'fwl3': {'66': 'N', '67': 'R', '68': 'D', '69': 'S', '70': 'G', '71': 'V', '72': 'P', '74': 'D', '75': 'R', '76': 'F', '77': 'S', '78': 'G', '79': 'S', '80': 'G', '83': 'S', '84': 'G', '85': 'T', '86': 'D', '87': 'F', '88': 'T', '89': 'L', '90': 'K', '91': 'I', '92': 'S', '93': 'R', '94': 'V', '95': 'E', '96': 'A', '97': 'E', '98': 'D', '99': 'V', '100': 'G', '101': 'V', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwl4': {'118': 'F', '119': 'G', '120': 'P', '121': 'G', '122': 'T', '123': 'T', '124': 'V', '125': 'D', '126': 'I', '127': 'K'}}, 'north': {'cdrl3': {'105': 'M', '106': 'Q', '107': 'A', '108': 'L', '109': 'Q', '114': 'V', '115': 'H', '116': 'S', '117': 'T'}, 'fwl1': {'3': 'V', '4': 'L', '5': 'T', '6': 'Q', '7': 'S', '8': 'P', '9': 'L', '10': 'S', '11': 'L', '12': 'P', '13': 'V', '14': 'T', '15': 'L', '16': 'G', '17': 'Q', '18': 'P', '19': 'A', '20': 'S', '21': 'I', '22': 'S', '23': 'C'}, 'cdrl1': {'24': 'R', '25': 'S', '26': 'S', '27': 'Q', '28': 'S', '29': 'L', '30': 'V', '31': 'F', '32': 'S', '34': 'D', '35': 'G', '36': 'N', '37': 'T', '38': 'Y', '39': 'L', '40': 'H'}, 'fwl2': {'41': 'W', '42': 'F', '43': 'Q', '44': 'Q', '45': 'R', '46': 'P', '47': 'G', '48': 'Q', '49': 'P', '50': 'P', '51': 'R', '52': 'R', '53': 'L', '54': 'I'}, 'cdrl2': {'55': 'Y', '56': 'Q', '57': 'V', '65': 'S', '66': 'N', '67': 'R', '68': 'D', '69': 'S'}, 'fwl3': {'70': 'G', '71': 'V', '72': 'P', '74': 'D', '75': 'R', '76': 'F', '77': 'S', '78': 'G', '79': 'S', '80': 'G', '83': 'S', '84': 'G', '85': 'T', '86': 'D', '87': 'F', '88': 'T', '89': 'L', '90': 'K', '91': 'I', '92': 'S', '93': 'R', '94': 'V', '95': 'E', '96': 'A', '97': 'E', '98': 'D', '99': 'V', '100': 'G', '101': 'V', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwl4': {'118': 'F', '119': 'G', '120': 'P', '121': 'G', '122': 'T', '123': 'T', '124': 'V', '125': 'D', '126': 'I', '127': 'K'}}, 'chothia': {'cdrl3': {'105': 'M', '106': 'Q', '107': 'A', '108': 'L', '109': 'Q', '114': 'V', '115': 'H', '116': 'S', '117': 'T'}, 'fwl1': {'3': 'V', '4': 'L', '5': 'T', '6': 'Q', '7': 'S', '8': 'P', '9': 'L', '10': 'S', '11': 'L', '12': 'P', '13': 'V', '14': 'T', '15': 'L', '16': 'G', '17': 'Q', '18': 'P', '19': 'A', '20': 'S', '21': 'I', '22': 'S', '23': 'C'}, 'cdrl1': {'24': 'R', '25': 'S', '26': 'S', '27': 'Q', '28': 'S', '29': 'L', '30': 'V', '31': 'F', '32': 'S', '34': 'D', '35': 'G', '36': 'N', '37': 'T', '38': 'Y', '39': 'L', '40': 'H'}, 'fwl2': {'41': 'W', '42': 'F', '43': 'Q', '44': 'Q', '45': 'R', '46': 'P', '47': 'G', '48': 'Q', '49': 'P', '50': 'P', '51': 'R', '52': 'R', '53': 'L', '54': 'I', '55': 'Y'}, 'cdrl2': {'56': 'Q', '57': 'V', '65': 'S', '66': 'N', '67': 'R', '68': 'D', '69': 'S'}, 'fwl3': {'70': 'G', '71': 'V', '72': 'P', '74': 'D', '75': 'R', '76': 'F', '77': 'S', '78': 'G', '79': 'S', '80': 'G', '83': 'S', '84': 'G', '85': 'T', '86': 'D', '87': 'F', '88': 'T', '89': 'L', '90': 'K', '91': 'I', '92': 'S', '93': 'R', '94': 'V', '95': 'E', '96': 'A', '97': 'E', '98': 'D', '99': 'V', '100': 'G', '101': 'V', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwl4': {'118': 'F', '119': 'G', '120': 'P', '121': 'G', '122': 'T', '123': 'T', '124': 'V', '125': 'D', '126': 'I', '127': 'K'}}, 'kabat': {'cdrl3': {'105': 'M', '106': 'Q', '107': 'A', '108': 'L', '109': 'Q', '114': 'V', '115': 'H', '116': 'S', '117': 'T'}, 'fwl1': {'3': 'V', '4': 'L', '5': 'T', '6': 'Q', '7': 'S', '8': 'P', '9': 'L', '10': 'S', '11': 'L', '12': 'P', '13': 'V', '14': 'T', '15': 'L', '16': 'G', '17': 'Q', '18': 'P', '19': 'A', '20': 'S', '21': 'I', '22': 'S', '23': 'C'}, 'cdrl1': {'24': 'R', '25': 'S', '26': 'S', '27': 'Q', '28': 'S', '29': 'L', '30': 'V', '31': 'F', '32': 'S', '34': 'D', '35': 'G', '36': 'N', '37': 'T', '38': 'Y', '39': 'L', '40': 'H'}, 'fwl2': {'41': 'W', '42': 'F', '43': 'Q', '44': 'Q', '45': 'R', '46': 'P', '47': 'G', '48': 'Q', '49': 'P', '50': 'P', '51': 'R', '52': 'R', '53': 'L', '54': 'I', '55': 'Y'}, 'cdrl2': {'56': 'Q', '57': 'V', '65': 'S', '66': 'N', '67': 'R', '68': 'D', '69': 'S'}, 'fwl3': {'70': 'G', '71': 'V', '72': 'P', '74': 'D', '75': 'R', '76': 'F', '77': 'S', '78': 'G', '79': 'S', '80': 'G', '83': 'S', '84': 'G', '85': 'T', '86': 'D', '87': 'F', '88': 'T', '89': 'L', '90': 'K', '91': 'I', '92': 'S', '93': 'R', '94': 'V', '95': 'E', '96': 'A', '97': 'E', '98': 'D', '99': 'V', '100': 'G', '101': 'V', '102': 'Y', '103': 'Y', '104': 'C'}, 'fwl4': {'118': 'F', '119': 'G', '120': 'P', '121': 'G', '122': 'T', '123': 'T', '124': 'V', '125': 'D', '126': 'I', '127': 'K'}}}
ABodyBuilder2 \\ //
A Method for Antibody Structure Prediction \\ //
Author: Brennan Abanades Kenyon ||
Supervisor: Charlotte Deane ||
Sequences loaded succesfully.
Heavy and light chains are:
H: EVQLVQSGGGLVKPGGSLRLSCAASGFTFSGYTMNWVRQAPGKGLEWVSGISGNSGIIEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDILGGFYYFDYWGQGTPVTVSS
L: VLTQSPLSLPVTLGQPASISCRSSQSLVFSDGNTYLHWFQQRPGQPPRRLIYQVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQVHSTFGPGTTVDIK
Running sequences through deep learning model...
Antibody modelled succesfully, starting refinement.
Refinement finished. Saving final structure to Fv1/Fv1.pdb
[((1, ' '), '-'), ((2, ' '), '-'), ((3, ' '), 'V'), ((4, ' '), 'L'), ((5, ' '), 'T'), ((6, ' '), 'Q'), ((7, ' '), 'S'), ((8, ' '), 'P'), ((9, ' '), 'L'), ((10, ' '), 'S'), ((11, ' '), 'L'), ((12, ' '), 'P'), ((13, ' '), 'V'), ((14, ' '), 'T'), ((15, ' '), 'L'), ((16, ' '), 'G'), ((17, ' '), 'Q'), ((18, ' '), 'P'), ((19, ' '), 'A'), ((20, ' '), 'S'), ((21, ' '), 'I'), ((22, ' '), 'S'), ((23, ' '), 'C'), ((24, ' '), 'R'), ((25, ' '), 'S'), ((26, ' '), 'S'), ((27, ' '), 'Q'), ((28, ' '), 'S'), ((29, ' '), 'L'), ((30, ' '), 'V'), ((31, ' '), 'F'), ((32, ' '), 'S'), ((33, ' '), '-'), ((34, ' '), 'D'), ((35, ' '), 'G'), ((36, ' '), 'N'), ((37, ' '), 'T'), ((38, ' '), 'Y'), ((39, ' '), 'L'), ((40, ' '), 'H'), ((41, ' '), 'W'), ((42, ' '), 'F'), ((43, ' '), 'Q'), ((44, ' '), 'Q'), ((45, ' '), 'R'), ((46, ' '), 'P'), ((47, ' '), 'G'), ((48, ' '), 'Q'), ((49, ' '), 'P'), ((50, ' '), 'P'), ((51, ' '), 'R'), ((52, ' '), 'R'), ((53, ' '), 'L'), ((54, ' '), 'I'), ((55, ' '), 'Y'), ((56, ' '), 'Q'), ((57, ' '), 'V'), ((58, ' '), '-'), ((59, ' '), '-'), ((60, ' '), '-'), ((61, ' '), '-'), ((62, ' '), '-'), ((63, ' '), '-'), ((64, ' '), '-'), ((65, ' '), 'S'), ((66, ' '), 'N'), ((67, ' '), 'R'), ((68, ' '), 'D'), ((69, ' '), 'S'), ((70, ' '), 'G'), ((71, ' '), 'V'), ((72, ' '), 'P'), ((73, ' '), '-'), ((74, ' '), 'D'), ((75, ' '), 'R'), ((76, ' '), 'F'), ((77, ' '), 'S'), ((78, ' '), 'G'), ((79, ' '), 'S'), ((80, ' '), 'G'), ((81, ' '), '-'), ((82, ' '), '-'), ((83, ' '), 'S'), ((84, ' '), 'G'), ((85, ' '), 'T'), ((86, ' '), 'D'), ((87, ' '), 'F'), ((88, ' '), 'T'), ((89, ' '), 'L'), ((90, ' '), 'K'), ((91, ' '), 'I'), ((92, ' '), 'S'), ((93, ' '), 'R'), ((94, ' '), 'V'), ((95, ' '), 'E'), ((96, ' '), 'A'), ((97, ' '), 'E'), ((98, ' '), 'D'), ((99, ' '), 'V'), ((100, ' '), 'G'), ((101, ' '), 'V'), ((102, ' '), 'Y'), ((103, ' '), 'Y'), ((104, ' '), 'C'), ((105, ' '), 'M'), ((106, ' '), 'Q'), ((107, ' '), 'A'), ((108, ' '), 'L'), ((109, ' '), 'Q'), ((110, ' '), '-'), ((111, ' '), '-'), ((112, ' '), '-'), ((113, ' '), '-'), ((114, ' '), 'V'), ((115, ' '), 'H'), ((116, ' '), 'S'), ((117, ' '), 'T'), ((118, ' '), 'F'), ((119, ' '), 'G'), ((120, ' '), 'P'), ((121, ' '), 'G'), ((122, ' '), 'T'), ((123, ' '), 'T'), ((124, ' '), 'V'), ((125, ' '), 'D'), ((126, ' '), 'I'), ((127, ' '), 'K')]
----------------------------------------------------------------------------------------------------
Calling ABodyBuilder2 (ImmuneBuilder model for antibodies) to model your Fv
----------------------------------------------------------------------------------------------------
ABodyBuilder2 (ImmuneBuilder) successfully modelled your Fv. Now assigning canonical forms to the loops...
----------------------------------------------------------------------------------------------------
Finally, calculating surface hydrophobicity and charge properties for your Fv at pH 7.4 (with salt-bridge correction)...
Temporary results stored in /tmp/tmpqp4fcqw9
# produced by psa, version 2.0 (Feb 2000)
#
# File of summed (Sum) and % (per.) accessibilities
# probe radius : 1.400
# integration step : 0.050
# water included : F
# hetatom included : T
# accessibility type : CONTACT
# number of residues : 230
#
# Res Res All atoms Non P side Polar Side Total Side Main Chain
# Num type Sum Per. Sum Per. Sum Per. Sum Per. Sum Per.
ACCESS 1 GLU ! 51.08105.2 41.37209.5 9.70 51.5 51.08132.3 0.00 0.0
ACCESS 2 VAL ! 4.66 9.8 3.76 9.9 0.00 0.0 3.76 9.9 0.91 9.3
ACCESS 3 GLN ! 27.63 53.5 23.99141.1 3.64 14.7 27.63 66.3 0.00 0.0
ACCESS 4 LEU ! 1.44 2.5 1.44 3.1 0.00 0.0 1.44 3.1 0.00 0.0
ACCESS 5 VAL ! 26.42 55.4 26.42 69.7 0.00 0.0 26.42 69.7 0.00 0.0
ACCESS 6 GLN ! 0.80 1.6 0.00 0.0 0.00 0.0 0.00 0.0 0.80 8.1
ACCESS 7 SER ! 21.48 63.6 21.32135.3 0.16 2.0 21.48 90.9 0.00 0.0
ACCESS 8 GLY ! 10.89 45.9 10.88100.4 0.00 0.0 10.88100.4 0.01 0.1
ACCESS 9 GLY ! 5.53 23.3 0.97 8.9 0.00 0.0 0.97 8.9 4.56 35.3
ACCESS 11 GLY ! 10.41 43.8 10.35 95.5 0.00 0.0 10.35 95.5 0.06 0.5
ACCESS 12 LEU ! 33.98 60.1 30.60 65.7 0.00 0.0 30.60 65.7 3.37 34.0
ACCESS 13 VAL ! 5.64 11.8 5.64 14.9 0.00 0.0 5.64 14.9 0.00 0.0
ACCESS 14 LYS ! 43.35 70.5 43.35112.0 0.00 0.0 43.35 84.1 0.00 0.0
ACCESS 15 PRO ! 21.06 47.3 17.74 45.2 0.00 0.0 17.74 45.2 3.33 62.9
ACCESS 16 GLY ! 16.74 70.5 12.81118.2 0.00 0.0 12.81118.2 3.93 30.4
ACCESS 17 GLY ! 7.44 31.3 7.32 67.6 0.00 0.0 7.32 67.6 0.12 0.9
ACCESS 18 SER ! 17.14 50.8 14.51 92.0 0.22 2.8 14.72 62.3 2.42 23.9
ACCESS 19 LEU ! 11.73 20.7 11.73 25.2 0.00 0.0 11.73 25.2 0.00 0.0
ACCESS 20 ARG ! 30.60 42.2 28.43109.7 1.62 4.4 30.05 48.0 0.55 5.5
ACCESS 21 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 22 SER ! 5.38 15.9 4.99 31.7 0.38 4.9 5.38 22.8 0.00 0.0
ACCESS 23 CYS ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 24 ALA ! 12.46 37.4 12.42 53.6 0.00 0.0 12.42 53.6 0.04 0.4
ACCESS 25 ALA ! 0.03 0.1 0.00 0.0 0.00 0.0 0.00 0.0 0.03 0.3
ACCESS 26 SER ! 15.40 45.6 13.83 87.8 1.57 20.0 15.40 65.2 0.00 0.0
ACCESS 27 GLY ! 16.62 70.0 12.49115.2 0.00 0.0 12.49115.2 4.13 32.0
ACCESS 28 PHE ! 9.47 15.6 7.51 14.6 0.00 0.0 7.51 14.6 1.96 21.1
ACCESS 29 THR ! 33.63 80.4 32.10128.8 1.45 20.6 33.54105.1 0.09 0.9
ACCESS 30 PHE ! 0.30 0.5 0.30 0.6 0.00 0.0 0.30 0.6 0.00 0.0
ACCESS 35 SER ! 16.06 47.6 15.36 97.5 0.00 0.0 15.36 65.0 0.70 6.9
ACCESS 36 GLY ! 11.02 46.4 9.82 90.6 0.00 0.0 9.82 90.6 1.20 9.3
ACCESS 37 TYR ! 16.80 27.0 14.56 34.4 2.23 21.2 16.80 31.7 0.00 0.0
ACCESS 38 THR ! 1.49 3.6 1.49 6.0 0.00 0.0 1.49 4.7 0.00 0.0
ACCESS 39 MET ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 40 ASN ! 1.24 3.0 1.24 8.5 0.00 0.0 1.24 4.0 0.00 0.0
ACCESS 41 TRP ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 42 VAL ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 43 ARG ! 1.42 2.0 1.42 5.5 0.00 0.0 1.42 2.3 0.00 0.0
ACCESS 44 GLN ! 4.14 8.0 3.44 20.2 0.70 2.8 4.14 9.9 0.00 0.0
ACCESS 45 ALA ! 6.37 19.2 6.37 27.5 0.00 0.0 6.37 27.5 0.00 0.0
ACCESS 46 PRO ! 29.73 66.7 29.42 74.9 0.00 0.0 29.42 74.9 0.31 5.9
ACCESS 47 GLY ! 24.59103.5 21.27196.3 0.00 0.0 21.27196.3 3.32 25.7
ACCESS 48 LYS ! 45.54 74.1 45.24116.8 0.00 0.0 45.24 87.8 0.29 2.9
ACCESS 49 GLY ! 6.55 27.6 5.94 54.8 0.00 0.0 5.94 54.8 0.61 4.7
ACCESS 50 LEU ! 1.22 2.2 0.00 0.0 0.00 0.0 0.00 0.0 1.22 12.3
ACCESS 51 GLU ! 15.33 31.6 13.37 67.7 1.96 10.4 15.33 39.7 0.00 0.0
ACCESS 52 TRP ! 2.55 3.4 2.55 4.4 0.00 0.0 2.55 3.9 0.00 0.0
ACCESS 53 VAL ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 54 SER ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 55 GLY ! 1.76 7.4 1.55 14.3 0.00 0.0 1.55 14.3 0.22 1.7
ACCESS 56 ILE ! 0.05 0.1 0.05 0.1 0.00 0.0 0.05 0.1 0.00 0.0
ACCESS 57 SER ! 1.04 3.1 1.04 6.6 0.00 0.0 1.04 4.4 0.00 0.0
ACCESS 58 GLY ! 0.17 0.7 0.17 1.5 0.00 0.0 0.17 1.5 0.00 0.0
ACCESS 59 ASN ! 36.56 89.4 33.14227.6 0.61 3.7 33.75109.1 2.81 28.2
ACCESS 62 SER ! 13.09 38.8 11.61 73.7 0.10 1.3 11.71 49.6 1.38 13.6
ACCESS 63 GLY ! 17.06 71.8 11.43105.4 0.00 0.0 11.43105.4 5.63 43.6
ACCESS 64 ILE ! 40.07 72.2 40.07 87.7 0.00 0.0 40.07 87.7 0.00 0.0
ACCESS 65 ILE ! 16.91 30.5 15.42 33.7 0.00 0.0 15.42 33.7 1.49 15.2
ACCESS 66 GLU ! 11.16 23.0 9.86 49.9 1.30 6.9 11.16 28.9 0.00 0.0
ACCESS 67 TYR ! 9.52 15.3 9.52 22.5 0.00 0.0 9.52 18.0 0.00 0.0
ACCESS 68 ALA ! 2.23 6.7 2.23 9.6 0.00 0.0 2.23 9.6 0.00 0.0
ACCESS 69 ASP ! 29.60 75.2 18.97118.9 6.13 45.6 25.10 85.4 4.51 45.2
ACCESS 70 SER ! 15.22 45.1 15.07 95.6 0.00 0.0 15.07 63.8 0.16 1.5
ACCESS 71 VAL ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 72 LYS ! 27.67 45.0 26.00 67.1 0.00 0.0 26.00 50.4 1.68 16.9
ACCESS 74 GLY ! 23.67 99.7 18.34169.2 0.00 0.0 18.34169.2 5.34 41.3
ACCESS 75 ARG ! 10.47 14.4 10.47 40.4 0.00 0.0 10.47 16.7 0.00 0.0
ACCESS 76 PHE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 77 THR ! 19.09 45.6 17.85 71.6 1.24 17.7 19.09 59.8 0.00 0.0
ACCESS 78 ILE ! 0.08 0.1 0.00 0.0 0.00 0.0 0.00 0.0 0.08 0.8
ACCESS 79 SER ! 10.10 29.9 10.10 64.1 0.00 0.0 10.10 42.7 0.00 0.0
ACCESS 80 ARG ! 4.11 5.7 1.31 5.1 0.00 0.0 1.31 2.1 2.80 28.2
ACCESS 81 ASP ! 8.56 21.7 7.60 47.7 0.95 7.1 8.56 29.1 0.00 0.0
ACCESS 82 ASN ! 15.41 37.7 12.97 89.0 0.00 0.0 12.97 41.9 2.44 24.5
ACCESS 83 SER ! 29.52 87.4 24.85157.7 0.11 1.4 24.96105.7 4.56 44.9
ACCESS 84 LYS ! 51.13 83.2 50.17129.6 0.00 0.0 50.17 97.4 0.96 9.7
ACCESS 85 ASN ! 19.13 46.8 17.42119.6 1.71 10.4 19.13 61.8 0.00 0.0
ACCESS 86 THR ! 4.03 9.6 3.59 14.4 0.44 6.3 4.03 12.6 0.00 0.0
ACCESS 87 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 88 TYR ! 12.21 19.6 10.30 24.3 1.92 18.2 12.21 23.1 0.00 0.0
ACCESS 89 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 90 GLN ! 14.62 28.3 14.03 82.5 0.59 2.4 14.62 35.1 0.00 0.0
ACCESS 91 MET ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 92 ASN ! 13.17 32.2 11.71 80.4 1.46 8.9 13.17 42.6 0.00 0.0
ACCESS 93 SER ! 20.09 59.5 18.67118.5 1.42 18.1 20.09 85.1 0.00 0.0
ACCESS 94 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 95 ARG ! 39.61 54.6 38.13147.1 1.48 4.0 39.61 63.2 0.00 0.0
ACCESS 96 ALA ! 20.33 61.1 20.19 87.2 0.00 0.0 20.19 87.2 0.14 1.4
ACCESS 97 GLU ! 28.84 59.4 26.58134.6 1.86 9.8 28.44 73.7 0.40 4.1
ACCESS 98 ASP ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 99 THR ! 8.41 20.1 8.41 33.8 0.00 0.0 8.41 26.4 0.00 0.0
ACCESS 100 ALA ! 0.52 1.6 0.03 0.1 0.00 0.0 0.03 0.1 0.49 4.9
ACCESS 101 LEU ! 13.98 24.7 13.98 30.0 0.00 0.0 13.98 30.0 0.00 0.0
ACCESS 102 TYR ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 103 TYR ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 104 CYS ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 105 ALA ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 106 LYS ! 2.08 3.4 2.08 5.4 0.00 0.0 2.08 4.0 0.00 0.0
ACCESS 107 ASP ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 108 ILE ! 13.75 24.8 13.75 30.1 0.00 0.0 13.75 30.1 0.00 0.0
ACCESS 109 LEU ! 21.83 38.6 18.83 40.4 0.00 0.0 18.83 40.4 3.00 30.3
ACCESS 110 GLY ! 17.00 71.6 14.63135.0 0.00 0.0 14.63135.0 2.37 18.4
ACCESS 111 GLY ! 14.00 59.0 13.03120.2 0.00 0.0 13.03120.2 0.97 7.5
ACCESS 112 PHE ! 0.37 0.6 0.37 0.7 0.00 0.0 0.37 0.7 0.00 0.0
ACCESS 113 TYR ! 22.95 36.9 21.74 51.3 1.21 11.5 22.95 43.4 0.00 0.0
ACCESS 114 TYR ! 8.64 13.9 7.68 18.1 0.96 9.1 8.64 16.3 0.00 0.0
ACCESS 115 PHE ! 0.12 0.2 0.12 0.2 0.00 0.0 0.12 0.2 0.00 0.0
ACCESS 116 ASP ! 3.27 8.3 1.42 8.9 0.75 5.6 2.18 7.4 1.09 10.9
ACCESS 117 TYR ! 27.85 44.8 26.15 61.8 1.70 16.1 27.85 52.6 0.00 0.0
ACCESS 118 TRP ! 4.05 5.4 1.86 3.2 0.00 0.0 1.86 2.9 2.19 21.6
ACCESS 119 GLY ! 0.64 2.7 0.62 5.7 0.00 0.0 0.62 5.7 0.02 0.2
ACCESS 120 GLN ! 31.49 61.0 29.73174.9 0.27 1.1 30.00 72.0 1.49 15.0
ACCESS 121 GLY ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 122 THR ! 0.02 0.0 0.02 0.1 0.00 0.0 0.02 0.1 0.00 0.0
ACCESS 123 PRO ! 26.87 60.3 26.87 68.4 0.00 0.0 26.87 68.4 0.00 0.0
ACCESS 124 VAL ! 0.35 0.7 0.30 0.8 0.00 0.0 0.30 0.8 0.05 0.5
ACCESS 125 THR ! 17.01 40.6 15.08 60.5 1.92 27.5 17.01 53.3 0.00 0.0
ACCESS 126 VAL ! 0.66 1.4 0.00 0.0 0.00 0.0 0.00 0.0 0.66 6.7
ACCESS 127 SER ! 12.39 36.7 9.89 62.8 2.50 31.8 12.39 52.4 0.00 0.0
ACCESS 128 SER ! 33.42 99.0 28.76182.5 2.98 37.9 31.74134.4 1.68 16.5
ACCESS 3 VAL ! 33.71 70.6 33.71 89.0 0.00 0.0 33.71 89.0 0.00 0.0
ACCESS 4 LEU ! 0.36 0.6 0.25 0.5 0.00 0.0 0.25 0.5 0.11 1.1
ACCESS 5 THR ! 24.89 59.5 24.66 98.9 0.24 3.4 24.89 78.0 0.00 0.0
ACCESS 6 GLN ! 0.27 0.5 0.00 0.0 0.00 0.0 0.00 0.0 0.27 2.7
ACCESS 7 SER ! 18.40 54.5 18.40116.8 0.00 0.0 18.40 77.9 0.00 0.0
ACCESS 8 PRO ! 18.00 40.4 18.00 45.8 0.00 0.0 18.00 45.8 0.00 0.0
ACCESS 9 LEU ! 35.09 62.1 35.05 75.2 0.00 0.0 35.05 75.2 0.04 0.4
ACCESS 10 SER ! 15.50 45.9 13.91 88.3 0.83 10.5 14.74 62.4 0.77 7.5
ACCESS 11 LEU ! 9.80 17.3 9.80 21.0 0.00 0.0 9.80 21.0 0.00 0.0
ACCESS 12 PRO ! 18.43 41.3 18.19 46.3 0.00 0.0 18.19 46.3 0.24 4.6
ACCESS 13 VAL ! 3.58 7.5 3.58 9.4 0.00 0.0 3.58 9.4 0.00 0.0
ACCESS 14 THR ! 18.18 43.5 16.87 67.7 1.32 18.8 18.18 56.9 0.00 0.0
ACCESS 15 LEU ! 25.60 45.3 24.97 53.6 0.00 0.0 24.97 53.6 0.63 6.3
ACCESS 16 GLY ! 7.92 33.3 7.27 67.1 0.00 0.0 7.27 67.1 0.64 5.0
ACCESS 17 GLN ! 27.98 54.2 21.92128.9 6.07 24.6 27.98 67.2 0.00 0.0
ACCESS 18 PRO ! 29.26 65.6 27.78 70.7 0.00 0.0 27.78 70.7 1.48 28.0
ACCESS 19 ALA ! 1.97 5.9 1.97 8.5 0.00 0.0 1.97 8.5 0.00 0.0
ACCESS 20 SER ! 14.19 42.0 12.18 77.3 0.90 11.4 13.08 55.4 1.11 11.0
ACCESS 21 ILE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 22 SER ! 9.94 29.4 9.53 60.5 0.39 5.0 9.92 42.0 0.02 0.2
ACCESS 23 CYS ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 24 ARG ! 49.60 68.3 47.54183.4 1.99 5.4 49.53 79.0 0.08 0.8
ACCESS 25 SER ! 0.55 1.6 0.03 0.2 0.00 0.0 0.03 0.1 0.53 5.2
ACCESS 26 SER ! 22.28 66.0 18.49117.3 0.00 0.0 18.49 78.3 3.79 37.3
ACCESS 27 GLN ! 35.76 69.3 33.93199.6 1.83 7.4 35.76 85.8 0.00 0.0
ACCESS 28 SER ! 17.30 51.2 17.30109.8 0.00 0.0 17.30 73.2 0.00 0.0
ACCESS 29 LEU ! 0.28 0.5 0.28 0.6 0.00 0.0 0.28 0.6 0.00 0.0
ACCESS 30 VAL ! 19.80 41.5 17.54 46.3 0.00 0.0 17.54 46.3 2.26 23.0
ACCESS 31 PHE ! 23.34 38.4 23.22 45.1 0.00 0.0 23.22 45.1 0.12 1.3
ACCESS 32 SER ! 33.81100.1 28.35179.9 0.80 10.2 29.15123.4 4.66 45.9
ACCESS 34 ASP ! 21.97 55.8 16.44103.0 0.21 1.6 16.65 56.6 5.32 53.3
ACCESS 35 GLY ! 16.98 71.5 12.33113.8 0.00 0.0 12.33113.8 4.64 36.0
ACCESS 36 ASN ! 15.46 37.8 13.30 91.3 2.14 13.0 15.44 49.9 0.02 0.3
ACCESS 37 THR ! 5.73 13.7 5.73 23.0 0.00 0.0 5.73 18.0 0.00 0.0
ACCESS 38 TYR ! 0.14 0.2 0.14 0.3 0.00 0.0 0.14 0.3 0.00 0.0
ACCESS 39 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 40 HIS ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 41 TRP ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 42 PHE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 43 GLN ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 44 GLN ! 3.65 7.1 3.22 18.9 0.41 1.7 3.63 8.7 0.02 0.2
ACCESS 45 ARG ! 13.55 18.7 13.48 52.0 0.06 0.2 13.55 21.6 0.00 0.0
ACCESS 46 PRO ! 32.80 73.6 30.94 78.8 0.00 0.0 30.94 78.8 1.85 35.1
ACCESS 47 GLY ! 26.16110.2 20.78191.7 0.00 0.0 20.78191.7 5.38 41.7
ACCESS 48 GLN ! 28.97 56.2 26.75157.4 2.22 9.0 28.97 69.5 0.00 0.0
ACCESS 49 PRO ! 8.88 19.9 8.88 22.6 0.00 0.0 8.88 22.6 0.00 0.0
ACCESS 50 PRO ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 51 ARG ! 21.21 29.2 20.66 79.7 0.56 1.5 21.21 33.9 0.00 0.0
ACCESS 52 ARG ! 4.13 5.7 3.95 15.2 0.00 0.0 3.95 6.3 0.18 1.8
ACCESS 53 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 54 ILE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 55 TYR ! 16.72 26.9 14.26 33.7 2.46 23.3 16.72 31.6 0.00 0.0
ACCESS 56 GLN ! 11.77 22.8 11.50 67.6 0.08 0.3 11.58 27.8 0.19 1.9
ACCESS 57 VAL ! 2.87 6.0 2.87 7.6 0.00 0.0 2.87 7.6 0.00 0.0
ACCESS 65 SER ! 15.92 47.2 12.89 81.8 2.07 26.3 14.96 63.3 0.97 9.5
ACCESS 66 ASN ! 17.83 43.6 10.78 74.1 7.05 43.0 17.83 57.7 0.00 0.0
ACCESS 67 ARG ! 32.30 44.5 28.28109.1 1.45 3.9 29.72 47.4 2.58 26.0
ACCESS 68 ASP ! 2.98 7.6 1.21 7.6 1.38 10.3 2.59 8.8 0.39 3.9
ACCESS 69 SER ! 31.13 92.2 25.78163.6 3.01 38.3 28.79121.9 2.34 23.0
ACCESS 70 GLY ! 23.22 97.8 21.93202.3 0.00 0.0 21.93202.3 1.30 10.0
ACCESS 71 VAL ! 2.25 4.7 0.27 0.7 0.00 0.0 0.27 0.7 1.98 20.2
ACCESS 72 PRO ! 13.83 31.0 13.83 35.2 0.00 0.0 13.83 35.2 0.00 0.0
ACCESS 74 ASP ! 27.13 68.9 14.52 91.0 11.89 88.5 26.41 89.8 0.71 7.2
ACCESS 75 ARG ! 5.30 7.3 5.30 20.4 0.00 0.0 5.30 8.5 0.00 0.0
ACCESS 76 PHE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 77 SER ! 11.45 33.9 10.06 63.8 1.40 17.8 11.45 48.5 0.00 0.0
ACCESS 78 GLY ! 0.15 0.6 0.00 0.0 0.00 0.0 0.00 0.0 0.15 1.2
ACCESS 79 SER ! 11.69 34.6 11.69 74.2 0.00 0.0 11.69 49.5 0.00 0.0
ACCESS 80 GLY ! 10.42 43.9 8.62 79.6 0.00 0.0 8.62 79.6 1.80 13.9
ACCESS 83 SER ! 25.08 74.3 21.99139.5 3.09 39.3 25.08106.2 0.00 0.0
ACCESS 84 GLY ! 5.52 23.3 5.52 51.0 0.00 0.0 5.52 51.0 0.00 0.0
ACCESS 85 THR ! 17.21 41.1 16.02 64.3 1.19 17.0 17.21 53.9 0.00 0.0
ACCESS 86 ASP ! 12.28 31.2 9.82 61.6 2.46 18.3 12.28 41.8 0.00 0.0
ACCESS 87 PHE ! 0.16 0.3 0.16 0.3 0.00 0.0 0.16 0.3 0.00 0.0
ACCESS 88 THR ! 7.50 17.9 6.28 25.2 1.23 17.5 7.50 23.5 0.00 0.0
ACCESS 89 LEU ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 90 LYS ! 30.79 50.1 30.79 79.5 0.00 0.0 30.79 59.7 0.00 0.0
ACCESS 91 ILE ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 92 SER ! 18.77 55.6 17.98114.1 0.00 0.0 17.98 76.1 0.79 7.8
ACCESS 93 ARG ! 52.83 72.8 51.20197.5 1.64 4.5 52.83 84.3 0.00 0.0
ACCESS 94 VAL ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 95 GLU ! 17.19 35.4 11.63 58.9 5.56 29.5 17.19 44.5 0.00 0.0
ACCESS 96 ALA ! 20.32 61.1 19.66 84.9 0.00 0.0 19.66 84.9 0.65 6.4
ACCESS 97 GLU ! 21.15 43.6 18.35 92.9 2.80 14.8 21.15 54.8 0.00 0.0
ACCESS 98 ASP ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 99 VAL ! 15.99 33.5 15.99 42.2 0.00 0.0 15.99 42.2 0.00 0.0
ACCESS 100 GLY ! 0.23 1.0 0.23 2.2 0.00 0.0 0.23 2.2 0.00 0.0
ACCESS 101 VAL ! 12.44 26.1 12.44 32.8 0.00 0.0 12.44 32.8 0.00 0.0
ACCESS 102 TYR ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 103 TYR ! 1.75 2.8 1.75 4.1 0.00 0.0 1.75 3.3 0.00 0.0
ACCESS 104 CYS ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 105 MET ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 106 GLN ! 0.11 0.2 0.11 0.7 0.00 0.0 0.11 0.3 0.00 0.0
ACCESS 107 ALA ! 0.58 1.7 0.57 2.5 0.00 0.0 0.57 2.5 0.01 0.1
ACCESS 108 LEU ! 9.02 16.0 6.80 14.6 0.00 0.0 6.80 14.6 2.22 22.4
ACCESS 109 GLN ! 14.04 27.2 11.45 67.3 1.19 4.8 12.64 30.3 1.40 14.1
ACCESS 114 VAL ! 37.83 79.3 36.36 96.0 0.00 0.0 36.36 96.0 1.47 15.0
ACCESS 115 HIS ! 15.48 28.2 14.11 46.4 1.37 9.0 15.48 33.9 0.00 0.0
ACCESS 116 SER ! 1.31 3.9 1.25 8.0 0.00 0.0 1.25 5.3 0.05 0.5
ACCESS 117 THR ! 9.58 22.9 9.58 38.4 0.00 0.0 9.58 30.0 0.00 0.0
ACCESS 118 PHE ! 1.99 3.3 0.80 1.6 0.00 0.0 0.80 1.6 1.18 12.8
ACCESS 119 GLY ! 0.48 2.0 0.11 1.0 0.00 0.0 0.11 1.0 0.37 2.9
ACCESS 120 PRO ! 19.38 43.5 17.12 43.6 0.00 0.0 17.12 43.6 2.26 42.7
ACCESS 121 GLY ! 0.79 3.3 0.33 3.1 0.00 0.0 0.33 3.1 0.45 3.5
ACCESS 122 THR ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 123 THR ! 15.37 36.7 14.65 58.8 0.72 10.3 15.37 48.1 0.00 0.0
ACCESS 124 VAL ! 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0 0.00 0.0
ACCESS 125 ASP ! 9.32 23.7 8.30 52.0 1.02 7.6 9.32 31.7 0.00 0.0
ACCESS 126 ILE ! 17.60 31.7 13.60 29.7 0.00 0.0 13.60 29.7 4.00 40.8
ACCESS 127 LYS ! 49.60 80.7 48.75125.9 0.00 0.0 48.75 94.6 0.84 8.5
('H', (1, '')) GLU Heavy Fv Charge is: -1
('H', (2, '')) VAL Heavy Fv Charge is: -1
('H', (3, '')) GLN Heavy Fv Charge is: -1
('H', (5, '')) VAL Heavy Fv Charge is: -1
('H', (7, '')) SER Heavy Fv Charge is: -1
('H', (8, '')) GLY Heavy Fv Charge is: -1
('H', (9, '')) GLY Heavy Fv Charge is: -1
('H', (11, '')) GLY Heavy Fv Charge is: -1
('H', (12, '')) LEU Heavy Fv Charge is: -1
('H', (13, '')) VAL Heavy Fv Charge is: -1
('H', (14, '')) LYS Heavy Fv Charge is: 0
('H', (15, '')) PRO Heavy Fv Charge is: 0
('H', (16, '')) GLY Heavy Fv Charge is: 0
('H', (17, '')) GLY Heavy Fv Charge is: 0
('H', (18, '')) SER Heavy Fv Charge is: 0
('H', (19, '')) LEU Heavy Fv Charge is: 0
('H', (20, '')) ARG Heavy Fv Charge is: 1
('H', (22, '')) SER Heavy Fv Charge is: 1
('H', (24, '')) ALA Heavy Fv Charge is: 1
('H', (26, '')) SER Heavy Fv Charge is: 1
('H', (27, '')) GLY Heavy Fv Charge is: 1
('H', (28, '')) PHE Heavy Fv Charge is: 1
('H', (29, '')) THR Heavy Fv Charge is: 1
('H', (35, '')) SER Heavy Fv Charge is: 1
('H', (36, '')) GLY Heavy Fv Charge is: 1
('H', (37, '')) TYR Heavy Fv Charge is: 1
('H', (44, '')) GLN Heavy Fv Charge is: 1
('H', (45, '')) ALA Heavy Fv Charge is: 1
('H', (46, '')) PRO Heavy Fv Charge is: 1
('H', (47, '')) GLY Heavy Fv Charge is: 1
('H', (48, '')) LYS Heavy Fv Charge is: 2
('H', (49, '')) GLY Heavy Fv Charge is: 2
('H', (51, '')) GLU Heavy Fv Charge is: 1
('H', (55, '')) GLY Heavy Fv Charge is: 1
('H', (59, '')) ASN Heavy Fv Charge is: 1
('H', (62, '')) SER Heavy Fv Charge is: 1
('H', (63, '')) GLY Heavy Fv Charge is: 1
('H', (64, '')) ILE Heavy Fv Charge is: 1
('H', (65, '')) ILE Heavy Fv Charge is: 1
('H', (66, '')) GLU Heavy Fv Charge is: 0
('H', (67, '')) TYR Heavy Fv Charge is: 0
('H', (68, '')) ALA Heavy Fv Charge is: 0
('H', (69, '')) ASP Heavy Fv Charge is: -1
('H', (70, '')) SER Heavy Fv Charge is: -1
('H', (72, '')) LYS Heavy Fv Charge is: 0
('H', (74, '')) GLY Heavy Fv Charge is: 0
('H', (75, '')) ARG Heavy Fv Charge is: 1
('H', (77, '')) THR Heavy Fv Charge is: 1
('H', (79, '')) SER Heavy Fv Charge is: 1
('H', (81, '')) ASP Heavy Fv Charge is: 0
('H', (82, '')) ASN Heavy Fv Charge is: 0
('H', (83, '')) SER Heavy Fv Charge is: 0
('H', (84, '')) LYS Heavy Fv Charge is: 1
('H', (85, '')) ASN Heavy Fv Charge is: 1
('H', (86, '')) THR Heavy Fv Charge is: 1
('H', (88, '')) TYR Heavy Fv Charge is: 1
('H', (90, '')) GLN Heavy Fv Charge is: 1
('H', (92, '')) ASN Heavy Fv Charge is: 1
('H', (93, '')) SER Heavy Fv Charge is: 1
('H', (95, '')) ARG Heavy Fv Charge is: 2
('H', (96, '')) ALA Heavy Fv Charge is: 2
('H', (97, '')) GLU Heavy Fv Charge is: 1
('H', (99, '')) THR Heavy Fv Charge is: 1
('H', (101, '')) LEU Heavy Fv Charge is: 1
('H', (108, '')) ILE Heavy Fv Charge is: 1
('H', (109, '')) LEU Heavy Fv Charge is: 1
('H', (110, '')) GLY Heavy Fv Charge is: 1
('H', (111, '')) GLY Heavy Fv Charge is: 1
('H', (113, '')) TYR Heavy Fv Charge is: 1
('H', (114, '')) TYR Heavy Fv Charge is: 1
('H', (117, '')) TYR Heavy Fv Charge is: 1
('H', (120, '')) GLN Heavy Fv Charge is: 1
('H', (123, '')) PRO Heavy Fv Charge is: 1
('H', (125, '')) THR Heavy Fv Charge is: 1
('H', (127, '')) SER Heavy Fv Charge is: 1
('H', (128, '')) SER Heavy Fv Charge is: 1
('H', (1, '')) GLU -1
('H', (14, '')) LYS 1
('H', (20, '')) ARG 1
('H', (48, '')) LYS 1
('H', (51, '')) GLU -1
('H', (66, '')) GLU -1
('H', (69, '')) ASP -1
('H', (72, '')) LYS 1
('H', (75, '')) ARG 1
('H', (81, '')) ASP -1
('H', (84, '')) LYS 1
('H', (95, '')) ARG 1
('H', (97, '')) GLU -1
('H', (1, '')) GLU Heavy Fv Charge is: 0
('H', (2, '')) VAL Heavy Fv Charge is: 0
('H', (3, '')) GLN Heavy Fv Charge is: 0
('H', (5, '')) VAL Heavy Fv Charge is: 0
('H', (7, '')) SER Heavy Fv Charge is: 0
('H', (8, '')) GLY Heavy Fv Charge is: 0
('H', (9, '')) GLY Heavy Fv Charge is: 0
('H', (11, '')) GLY Heavy Fv Charge is: 0
('H', (12, '')) LEU Heavy Fv Charge is: 0
('H', (13, '')) VAL Heavy Fv Charge is: 0
('H', (14, '')) LYS Heavy Fv Charge is: 1
('H', (15, '')) PRO Heavy Fv Charge is: 1
('H', (16, '')) GLY Heavy Fv Charge is: 1
('H', (17, '')) GLY Heavy Fv Charge is: 1
('H', (18, '')) SER Heavy Fv Charge is: 1
('H', (19, '')) LEU Heavy Fv Charge is: 1
('H', (20, '')) ARG Heavy Fv Charge is: 2
('H', (22, '')) SER Heavy Fv Charge is: 2
('H', (24, '')) ALA Heavy Fv Charge is: 2
('H', (26, '')) SER Heavy Fv Charge is: 2
('H', (27, '')) GLY Heavy Fv Charge is: 2
('H', (28, '')) PHE Heavy Fv Charge is: 2
('H', (29, '')) THR Heavy Fv Charge is: 2
('H', (35, '')) SER Heavy Fv Charge is: 2
('H', (36, '')) GLY Heavy Fv Charge is: 2
('H', (37, '')) TYR Heavy Fv Charge is: 2
('H', (44, '')) GLN Heavy Fv Charge is: 2
('H', (45, '')) ALA Heavy Fv Charge is: 2
('H', (46, '')) PRO Heavy Fv Charge is: 2
('H', (47, '')) GLY Heavy Fv Charge is: 2
('H', (48, '')) LYS Heavy Fv Charge is: 3
('H', (49, '')) GLY Heavy Fv Charge is: 3
('H', (51, '')) GLU Heavy Fv Charge is: 2
('H', (55, '')) GLY Heavy Fv Charge is: 2
('H', (59, '')) ASN Heavy Fv Charge is: 2
('H', (62, '')) SER Heavy Fv Charge is: 2
('H', (63, '')) GLY Heavy Fv Charge is: 2
('H', (64, '')) ILE Heavy Fv Charge is: 2
('H', (65, '')) ILE Heavy Fv Charge is: 2
('H', (66, '')) GLU Heavy Fv Charge is: 1
('H', (67, '')) TYR Heavy Fv Charge is: 1
('H', (68, '')) ALA Heavy Fv Charge is: 1
('H', (69, '')) ASP Heavy Fv Charge is: 0
('H', (70, '')) SER Heavy Fv Charge is: 0
('H', (72, '')) LYS Heavy Fv Charge is: 1
('H', (74, '')) GLY Heavy Fv Charge is: 1
('H', (75, '')) ARG Heavy Fv Charge is: 2
('H', (77, '')) THR Heavy Fv Charge is: 2
('H', (79, '')) SER Heavy Fv Charge is: 2
('H', (81, '')) ASP Heavy Fv Charge is: 1
('H', (82, '')) ASN Heavy Fv Charge is: 1
('H', (83, '')) SER Heavy Fv Charge is: 1
('H', (84, '')) LYS Heavy Fv Charge is: 2
('H', (85, '')) ASN Heavy Fv Charge is: 2
('H', (86, '')) THR Heavy Fv Charge is: 2
('H', (88, '')) TYR Heavy Fv Charge is: 2
('H', (90, '')) GLN Heavy Fv Charge is: 2
('H', (92, '')) ASN Heavy Fv Charge is: 2
('H', (93, '')) SER Heavy Fv Charge is: 2
('H', (95, '')) ARG Heavy Fv Charge is: 3
('H', (96, '')) ALA Heavy Fv Charge is: 3
('H', (97, '')) GLU Heavy Fv Charge is: 2
('H', (99, '')) THR Heavy Fv Charge is: 2
('H', (101, '')) LEU Heavy Fv Charge is: 2
('H', (108, '')) ILE Heavy Fv Charge is: 2
('H', (109, '')) LEU Heavy Fv Charge is: 2
('H', (110, '')) GLY Heavy Fv Charge is: 2
('H', (111, '')) GLY Heavy Fv Charge is: 2
('H', (113, '')) TYR Heavy Fv Charge is: 2
('H', (114, '')) TYR Heavy Fv Charge is: 2
('H', (117, '')) TYR Heavy Fv Charge is: 2
('H', (120, '')) GLN Heavy Fv Charge is: 2
('H', (123, '')) PRO Heavy Fv Charge is: 2
('H', (125, '')) THR Heavy Fv Charge is: 2
('H', (127, '')) SER Heavy Fv Charge is: 2
('H', (128, '')) SER Heavy Fv Charge is: 2
('L', (3, '')) VAL Light Fv Charge is: 0
('L', (5, '')) THR Light Fv Charge is: 0
('L', (7, '')) SER Light Fv Charge is: 0
('L', (8, '')) PRO Light Fv Charge is: 0
('L', (9, '')) LEU Light Fv Charge is: 0
('L', (10, '')) SER Light Fv Charge is: 0
('L', (11, '')) LEU Light Fv Charge is: 0
('L', (12, '')) PRO Light Fv Charge is: 0
('L', (13, '')) VAL Light Fv Charge is: 0
('L', (14, '')) THR Light Fv Charge is: 0
('L', (15, '')) LEU Light Fv Charge is: 0
('L', (16, '')) GLY Light Fv Charge is: 0
('L', (17, '')) GLN Light Fv Charge is: 0
('L', (18, '')) PRO Light Fv Charge is: 0
('L', (19, '')) ALA Light Fv Charge is: 0
('L', (20, '')) SER Light Fv Charge is: 0
('L', (22, '')) SER Light Fv Charge is: 0
('L', (24, '')) ARG Light Fv Charge is: 1
('L', (26, '')) SER Light Fv Charge is: 1
('L', (27, '')) GLN Light Fv Charge is: 1
('L', (28, '')) SER Light Fv Charge is: 1
('L', (30, '')) VAL Light Fv Charge is: 1
('L', (31, '')) PHE Light Fv Charge is: 1
('L', (32, '')) SER Light Fv Charge is: 1
('L', (34, '')) ASP Light Fv Charge is: 0
('L', (35, '')) GLY Light Fv Charge is: 0
('L', (36, '')) ASN Light Fv Charge is: 0
('L', (37, '')) THR Light Fv Charge is: 0
('L', (44, '')) GLN Light Fv Charge is: 0
('L', (45, '')) ARG Light Fv Charge is: 1
('L', (46, '')) PRO Light Fv Charge is: 1
('L', (47, '')) GLY Light Fv Charge is: 1
('L', (48, '')) GLN Light Fv Charge is: 1
('L', (49, '')) PRO Light Fv Charge is: 1
('L', (51, '')) ARG Light Fv Charge is: 2
('L', (55, '')) TYR Light Fv Charge is: 2
('L', (56, '')) GLN Light Fv Charge is: 2
('L', (57, '')) VAL Light Fv Charge is: 2
('L', (65, '')) SER Light Fv Charge is: 2
('L', (66, '')) ASN Light Fv Charge is: 2
('L', (67, '')) ARG Light Fv Charge is: 3
('L', (68, '')) ASP Light Fv Charge is: 2
('L', (69, '')) SER Light Fv Charge is: 2
('L', (70, '')) GLY Light Fv Charge is: 2
('L', (72, '')) PRO Light Fv Charge is: 2
('L', (74, '')) ASP Light Fv Charge is: 1
('L', (75, '')) ARG Light Fv Charge is: 2
('L', (77, '')) SER Light Fv Charge is: 2
('L', (79, '')) SER Light Fv Charge is: 2
('L', (80, '')) GLY Light Fv Charge is: 2
('L', (83, '')) SER Light Fv Charge is: 2
('L', (84, '')) GLY Light Fv Charge is: 2
('L', (85, '')) THR Light Fv Charge is: 2
('L', (86, '')) ASP Light Fv Charge is: 1
('L', (88, '')) THR Light Fv Charge is: 1
('L', (90, '')) LYS Light Fv Charge is: 2
('L', (92, '')) SER Light Fv Charge is: 2
('L', (93, '')) ARG Light Fv Charge is: 3
('L', (95, '')) GLU Light Fv Charge is: 2
('L', (96, '')) ALA Light Fv Charge is: 2
('L', (97, '')) GLU Light Fv Charge is: 1
('L', (99, '')) VAL Light Fv Charge is: 1
('L', (101, '')) VAL Light Fv Charge is: 1
('L', (108, '')) LEU Light Fv Charge is: 1
('L', (109, '')) GLN Light Fv Charge is: 1
('L', (114, '')) VAL Light Fv Charge is: 1
('L', (115, '')) HIS Light Fv Charge is: 1.1
('L', (117, '')) THR Light Fv Charge is: 1.1
('L', (120, '')) PRO Light Fv Charge is: 1.1
('L', (123, '')) THR Light Fv Charge is: 1.1
('L', (125, '')) ASP Light Fv Charge is: 0.10000000000000009
('L', (126, '')) ILE Light Fv Charge is: 0.10000000000000009
('L', (127, '')) LYS Light Fv Charge is: 1.1
We have 62 residues in the CDR vicinity of which 43 are genuine CDR residues.
A total of 149 residues have been recorded.
Checking for possible salt bridges using a distance cutoff of 3.2A between formally, oppositely charged residues.
('H', (1, '')) GLU -1
('H', (14, '')) LYS 1
('H', (20, '')) ARG 1
('H', (48, '')) LYS 1
('H', (51, '')) GLU -1
('H', (66, '')) GLU -1
('H', (69, '')) ASP -1
('H', (72, '')) LYS 1
('H', (75, '')) ARG 1
('H', (81, '')) ASP -1
('H', (84, '')) LYS 1
('H', (95, '')) ARG 1
('H', (97, '')) GLU -1
('L', (24, '')) ARG 1
('L', (34, '')) ASP -1
('L', (45, '')) ARG 1
('L', (51, '')) ARG 1
('L', (67, '')) ARG 1
('L', (68, '')) ASP -1
('L', (74, '')) ASP -1
('L', (75, '')) ARG 1
('L', (86, '')) ASP -1
('L', (90, '')) LYS 1
('L', (93, '')) ARG 1
('L', (95, '')) GLU -1
('L', (97, '')) GLU -1
('L', (115, '')) HIS 0.1
('L', (125, '')) ASP -1
('L', (127, '')) LYS 1
SUMMARY HYDROPHOBICITY AND CHARGE RESULTS:
ABSOLUTE SURFACE AREA VALUES
The Total Absolute Surface Area of your Fv is: 2713.74
The CDR Vicinity Absolute Surface Area of your Fv is: 1074.4600000000005
LINEARLY-WEIGHTED HYDROPHOBICITY AND CHARGE
The Total LINEARLY Surface-weighted Hydrophobicity of your Fv is: 3824.4626666666663
The CDR LINEARLY Surface-weighted Hydrophobicity of your Fv is: 1534.7292222222218
The Total LINEARLY Surface-weighted Charge of your Fv is: 252.85800000000003
The CDR LINEARLY Surface-weighted Charge of your Fv is: -75.722
Net Heavy Fv Charge of your Fv is: 1
Net Light Fv Charge of your Fv is: 1.1
Number of Charged CDR Residues in your Fv is: 5/43
Number of Charged Heavy Fv Residues in your Fv is: 26/76
Number of Charged Light Fv Residues in your Fv is: 16/73
Fraction of Charged CDR Residues in your Fv is: 0.11627906976744186
Fraction of Charged Heavy Fv Residues in your Fv is: 0.34210526315789475
Fraction of Charged Light Fv Residues in your Fv is: 0.2191780821917808
Number of Salt Bridges in your Fv is: 8
Salt bridge components: [('H72: LYS', 'H66: GLU', '2.7177'), ('H72: LYS', 'H69: ASP', '2.7673'), ('H84: LYS', 'H81: ASP', '2.6775'), ('H95: ARG', 'H97: GLU', '2.7371'), ('L24: ARG', 'L86: ASP', '2.6844'), ('L45: ARG', 'L97: GLU', '2.7466'), ('L75: ARG', 'L95: GLU', '2.7570'), ('L75: ARG', 'L97: GLU', '2.7756')]
PATCH-WEIGHTED HYDROPHOBICITY
The Total PATCH Surface-weighted Hydrophobicity of your Fv is: 497.77042839535716
The CDR PATCH Surface-weighted Hydrophobicity of your Fv is: 185.99336013513314
[('H', (26, '')), ('H', (2, '')), ('H', (3, '')), ('H', (27, '')), ('H', (28, '')), ('H', (85, '')), ('H', (1, '')), ('H', (29, '')), ('H', (37, '')), ('H', (35, '')), ('H', (36, '')), ('H', (82, '')), ('H', (109, '')), ('H', (108, '')), ('H', (55, '')), ('H', (65, '')), ('H', (66, '')), ('H', (67, '')), ('H', (59, '')), ('H', (62, '')), ('H', (63, '')), ('H', (64, '')), ('H', (72, '')), ('L', (114, '')), ('H', (68, '')), ('H', (69, '')), ('H', (77, '')), ('H', (110, '')), ('H', (113, '')), ('H', (114, '')), ('H', (111, '')), ('L', (55, '')), ('L', (56, '')), ('H', (117, '')), ('L', (26, '')), ('L', (3, '')), ('L', (27, '')), ('L', (28, '')), ('L', (85, '')), ('L', (109, '')), ('L', (30, '')), ('L', (84, '')), ('L', (108, '')), ('L', (31, '')), ('L', (35, '')), ('L', (36, '')), ('L', (37, '')), ('L', (32, '')), ('L', (34, '')), ('L', (57, '')), ('L', (83, '')), ('L', (65, '')), ('L', (66, '')), ('L', (67, '')), ('L', (68, '')), ('L', (79, '')), ('L', (80, '')), ('L', (72, '')), ('L', (74, '')), ('L', (77, '')), ('L', (115, '')), ('L', (117, ''))]
[('H', ('26', '')), ('H', ('2', '')), ('H', ('3', '')), ('H', ('27', '')), ('H', ('28', '')), ('H', ('85', '')), ('H', ('1', '')), ('H', ('29', '')), ('H', ('37', '')), ('H', ('35', '')), ('H', ('36', '')), ('H', ('82', '')), ('H', ('109', '')), ('H', ('108', '')), ('H', ('55', '')), ('H', ('65', '')), ('H', ('66', '')), ('H', ('67', '')), ('H', ('59', '')), ('H', ('62', '')), ('H', ('63', '')), ('H', ('64', '')), ('H', ('72', '')), ('L', ('114', '')), ('H', ('68', '')), ('H', ('69', '')), ('H', ('77', '')), ('H', ('110', '')), ('H', ('113', '')), ('H', ('114', '')), ('H', ('111', '')), ('L', ('55', '')), ('L', ('56', '')), ('H', ('117', '')), ('L', ('26', '')), ('L', ('3', '')), ('L', ('27', '')), ('L', ('28', '')), ('L', ('85', '')), ('L', ('109', '')), ('L', ('30', '')), ('L', ('84', '')), ('L', ('108', '')), ('L', ('31', '')), ('L', ('35', '')), ('L', ('36', '')), ('L', ('37', '')), ('L', ('32', '')), ('L', ('34', '')), ('L', ('57', '')), ('L', ('83', '')), ('L', ('65', '')), ('L', ('66', '')), ('L', ('67', '')), ('L', ('68', '')), ('L', ('79', '')), ('L', ('80', '')), ('L', ('72', '')), ('L', ('74', '')), ('L', ('77', '')), ('L', ('115', '')), ('L', ('117', ''))]
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
1 ('H', ('1', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
2 ('H', ('2', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
3 ('H', ('3', '')) yes
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
4 ('H', ('4', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
5 ('H', ('5', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
6 ('H', ('6', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
7 ('H', ('7', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
8 ('H', ('8', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
9 ('H', ('9', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
11 ('H', ('11', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
12 ('H', ('12', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
13 ('H', ('13', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
14 ('H', ('14', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
15 ('H', ('15', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
16 ('H', ('16', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
17 ('H', ('17', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
18 ('H', ('18', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
19 ('H', ('19', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
20 ('H', ('20', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
21 ('H', ('21', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
22 ('H', ('22', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
23 ('H', ('23', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
24 ('H', ('24', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
25 ('H', ('25', '')) no
is not in the CDR vic
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
26 ('H', ('26', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
27 ('H', ('27', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
28 ('H', ('28', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
29 ('H', ('29', '')) yes
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
30 ('H', ('30', '')) no
is not in the CDR vic
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
35 ('H', ('35', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
36 ('H', ('36', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
37 ('H', ('37', '')) yes
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
38 ('H', ('38', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
39 ('H', ('39', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
40 ('H', ('40', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
41 ('H', ('41', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
42 ('H', ('42', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
43 ('H', ('43', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
44 ('H', ('44', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
45 ('H', ('45', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
46 ('H', ('46', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
47 ('H', ('47', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
48 ('H', ('48', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
49 ('H', ('49', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
50 ('H', ('50', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
51 ('H', ('51', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
52 ('H', ('52', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
53 ('H', ('53', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
54 ('H', ('54', '')) no
is not in the CDR vic
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
55 ('H', ('55', '')) yes
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
56 ('H', ('56', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
57 ('H', ('57', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
58 ('H', ('58', '')) no
is not in the CDR vic
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
59 ('H', ('59', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
62 ('H', ('62', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
63 ('H', ('63', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
64 ('H', ('64', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
65 ('H', ('65', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
66 ('H', ('66', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
67 ('H', ('67', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
68 ('H', ('68', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
69 ('H', ('69', '')) yes
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
70 ('H', ('70', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
71 ('H', ('71', '')) no
is not in the CDR vic
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
72 ('H', ('72', '')) yes
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
74 ('H', ('74', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
75 ('H', ('75', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
76 ('H', ('76', '')) no
is not in the CDR vic
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
77 ('H', ('77', '')) yes
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
78 ('H', ('78', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
79 ('H', ('79', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
80 ('H', ('80', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
81 ('H', ('81', '')) no
is not in the CDR vic
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
82 ('H', ('82', '')) yes
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
83 ('H', ('83', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
84 ('H', ('84', '')) no
is not in the CDR vic
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
85 ('H', ('85', '')) yes
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
86 ('H', ('86', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
87 ('H', ('87', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
88 ('H', ('88', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
89 ('H', ('89', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
90 ('H', ('90', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
91 ('H', ('91', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
92 ('H', ('92', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
93 ('H', ('93', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
94 ('H', ('94', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
95 ('H', ('95', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
96 ('H', ('96', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
97 ('H', ('97', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
98 ('H', ('98', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
99 ('H', ('99', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
100 ('H', ('100', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
101 ('H', ('101', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
102 ('H', ('102', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
103 ('H', ('103', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
104 ('H', ('104', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
105 ('H', ('105', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
106 ('H', ('106', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
107 ('H', ('107', '')) no
is not in the CDR vic
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
108 ('H', ('108', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
109 ('H', ('109', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
110 ('H', ('110', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
111 ('H', ('111', '')) yes
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
112 ('H', ('112', '')) no
is not in the CDR vic
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
113 ('H', ('113', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
114 ('H', ('114', '')) yes
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
115 ('H', ('115', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
116 ('H', ('116', '')) no
is not in the CDR vic
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
117 ('H', ('117', '')) yes
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
118 ('H', ('118', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
119 ('H', ('119', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
120 ('H', ('120', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
121 ('H', ('121', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
122 ('H', ('122', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
123 ('H', ('123', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
124 ('H', ('124', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
125 ('H', ('125', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
126 ('H', ('126', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
127 ('H', ('127', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
128 ('H', ('128', '')) no
is not in the CDR vic
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
3 ('L', ('3', '')) yes
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
4 ('L', ('4', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
5 ('L', ('5', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
6 ('L', ('6', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
7 ('L', ('7', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
8 ('L', ('8', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
9 ('L', ('9', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
10 ('L', ('10', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
11 ('L', ('11', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
12 ('L', ('12', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
13 ('L', ('13', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
14 ('L', ('14', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
15 ('L', ('15', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
16 ('L', ('16', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
17 ('L', ('17', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
18 ('L', ('18', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
19 ('L', ('19', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
20 ('L', ('20', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
21 ('L', ('21', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
22 ('L', ('22', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
23 ('L', ('23', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
24 ('L', ('24', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
25 ('L', ('25', '')) no
is not in the CDR vic
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
26 ('L', ('26', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
27 ('L', ('27', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
28 ('L', ('28', '')) yes
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
29 ('L', ('29', '')) no
is not in the CDR vic
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
30 ('L', ('30', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
31 ('L', ('31', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
32 ('L', ('32', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
34 ('L', ('34', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
35 ('L', ('35', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
36 ('L', ('36', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
37 ('L', ('37', '')) yes
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
38 ('L', ('38', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
39 ('L', ('39', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
40 ('L', ('40', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
41 ('L', ('41', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
42 ('L', ('42', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
43 ('L', ('43', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
44 ('L', ('44', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
45 ('L', ('45', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
46 ('L', ('46', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
47 ('L', ('47', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
48 ('L', ('48', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
49 ('L', ('49', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
50 ('L', ('50', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
51 ('L', ('51', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
52 ('L', ('52', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
53 ('L', ('53', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
54 ('L', ('54', '')) no
is not in the CDR vic
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
55 ('L', ('55', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
56 ('L', ('56', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
57 ('L', ('57', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
65 ('L', ('65', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
66 ('L', ('66', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
67 ('L', ('67', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
68 ('L', ('68', '')) yes
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
69 ('L', ('69', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
70 ('L', ('70', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
71 ('L', ('71', '')) no
is not in the CDR vic
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
72 ('L', ('72', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
74 ('L', ('74', '')) yes
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
75 ('L', ('75', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
76 ('L', ('76', '')) no
is not in the CDR vic
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
77 ('L', ('77', '')) yes
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
78 ('L', ('78', '')) no
is not in the CDR vic
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
79 ('L', ('79', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
80 ('L', ('80', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
83 ('L', ('83', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
84 ('L', ('84', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
85 ('L', ('85', '')) yes
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
86 ('L', ('86', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
87 ('L', ('87', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
88 ('L', ('88', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
89 ('L', ('89', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
90 ('L', ('90', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
91 ('L', ('91', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
92 ('L', ('92', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
93 ('L', ('93', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
94 ('L', ('94', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
95 ('L', ('95', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
96 ('L', ('96', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
97 ('L', ('97', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
98 ('L', ('98', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
99 ('L', ('99', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
100 ('L', ('100', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
101 ('L', ('101', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
102 ('L', ('102', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
103 ('L', ('103', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
104 ('L', ('104', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
105 ('L', ('105', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
106 ('L', ('106', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
107 ('L', ('107', '')) no
is not in the CDR vic
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
108 ('L', ('108', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
109 ('L', ('109', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
114 ('L', ('114', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
115 ('L', ('115', '')) yes
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
116 ('L', ('116', '')) no
is not in the CDR vic
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
117 ('L', ('117', '')) yes
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
118 ('L', ('118', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
119 ('L', ('119', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
120 ('L', ('120', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
121 ('L', ('121', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
122 ('L', ('122', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
123 ('L', ('123', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
124 ('L', ('124', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
125 ('L', ('125', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
126 ('L', ('126', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
127 ('L', ('127', '')) no
is not in the CDR vic
----------------------------------------------------------------------------------------------------
TAP is Complete! It took 63.36s running on 1 core(s).
Summary Statistics for Fv1:
IMGT H3 Length: 13
Total IMGT CDR Length: 52 (GREEN flag)
Patch CDR Surface Hydrophobicity score is: 185.993400 (AMBER flag)
Patch CDR Positive Charge score is: 0.008200 (GREEN flag)
Patch CDR Negative Charge score is: 0.072000 (GREEN flag)
SFvCSP score is: 1.100000 (GREEN flag)
----------------------------------------------------------------------------------------------------
