SAbPred: TCRBuilder2 Results

> Job Status

Job ID:	TCRBuilder2_example
Job name:	my_tcr_model
Job status:	finished!
Log file:

        TCRBuilder2                                                 || ||
        A Method for T-Cell Receptor Structure Prediction          |VB|VA|
        Author: Brennan Abanades Kenyon                            |CB|CA|
        Supervisor: Charlotte Deane                             -------------

Sequences loaded succesfully.
Alpha and Beta chains are:
A: AQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSEQDDKIIFGKGTRLHILP
B: ADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDESYGYTFGSGTRLTVV
Running sequences through deep learning model...
TCR modelled succesfully, starting refinement.
Refinement finished. Saving final structure to ***/20221109_0601524/my_tcr_model.pdb

> Results

Downloads

IMGT-numbered TCR model (PDB format):	Download

Modelling scores

NB: The prediction error for each region is computed by taking the Root Mean Square (RMS) of the individual prediction errors for each residue in that region. For more information on how these are computed, please refer to the ImmuneBuilder paper.