Detailed entry information.
Click on any of the tabs below to see the detailed information about the structure.
Human Pre-T Cell Receptor Crystal Structure
| Item | Info |
|---|---|
| PDB | 3of6 |
| Organism | HOMO SAPIENS |
| Method | X-RAY DIFFRACTION |
| Resolution | 2.8Å |
| Number of TCRs | 3 |
This PDB has 3 TCR(s).
| Item | Info |
|---|---|
| VB chain | A |
| VB IMGT details | TRBV7/TRBJ2 |
| Species | human |
| Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| VB | A | FASTA file |
|
| Loop | Sequence | Predicted canonical form | CDR Length |
|---|---|---|---|
| CDRB3 | ASSLGQAYEQY | None | 11 |
| CDRB2 | FQNEAQ | None | 6 |
| CDRB1 | SGHVS | None | 5 |
| Item | Info |
|---|---|
| VB chain | B |
| VB IMGT details | TRBV7/TRBJ2 |
| Species | human |
| Item | Info |
|---|---|
| Antigen Chain | F |
| Antigen Type | Protein |
| Antigen Organism | HOMO SAPIENS |
| Antigen Sequence | GAHMLPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCSGDDDDK |
| Antigen Length | 130 |
| Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| VB | B | FASTA file |
|
| Loop | Sequence | Predicted canonical form | CDR Length |
|---|---|---|---|
| CDRB3 | ASSLGQAYEQY | None | 11 |
| CDRB2 | FQNEAQ | None | 6 |
| CDRB1 | SGHVS | None | 5 |
| Item | Info |
|---|---|
| VB chain | C |
| VB IMGT details | TRBV7/TRBJ2 |
| Species | human |
| Item | Info |
|---|---|
| Antigen Chain | E |
| Antigen Type | Protein |
| Antigen Organism | HOMO SAPIENS |
| Antigen Sequence | GAHMLPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCSGDDDDK |
| Antigen Length | 130 |
| Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| VB | C | FASTA file |
|
| Loop | Sequence | Predicted canonical form | CDR Length |
|---|---|---|---|
| CDRB3 | ASSLGQAYEQY | None | 11 |
| CDRB2 | FQNEAQ | None | 6 |
| CDRB1 | SGHVS | None | 5 |