Thera-SAbDab

LIRILUMAB

> Structural Summary

Therapeutic	Lirilumab
Target	KIRD2
Heavy Chain	QVQLVQSGAEVKKPGSSVKVSCKASGGTFSFYAISWVRQAPGQGLEWMGGFIPIFGAANYAQKFQGRVTITADESTSTAYMELSSLRSDDTAVYYCARIPSGSYYYDYDMDVWGQGTTVTVSS
Light Chain	EIVLTQSPVTLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWMYTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (January '23)	Phase-II
Estimated Status (January '23)	Active
Recorded Developmental Technology	Medarex UltiMAb Mouse
INN Year Proposed	2012
INN Year Recommended	2013
Companies Involved	Novo Nordisk, Bristol-Myers Squibb, Dana-Farber Cancer Institute, Innate Pharma, National Cancer Institute (USA), Ono Pharmaceutical, PrECOG, University of Texas M. D. Anderson Cancer Center
Conditions Approved	na
Conditions Active	Chronic lymphocytic leukaemia, Head and neck cancer, Myelodysplastic syndromes, Solid tumours, Bladder cancer
Conditions Discontinued	Acute myeloid leukaemia, Hepatitis C, Haematological malignancies, Multiple myeloma, Lymphoma
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy