Thera-SAbDab

MONALIZUMAB

> Structural Summary

Therapeutic	Monalizumab
Target	KLRC1
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMNWVRQAPGQGLEWMGRIDPYDSETHYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARGGYDFDVGTLYWFFDVWGQGTTVTVSS
Light Chain	DIQMTQSPSSLSASVGDRVTITCRASENIYSYLAWYQQKPGKAPKLLIYNAKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHHYGTPRTFGGGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (January '23)	Phase-III
Estimated Status (January '23)	Active
Recorded Developmental Technology	na
INN Year Proposed	2015
INN Year Recommended	2016
Companies Involved	Innate Pharma, MedImmune, NCIC Clinical Trials Group, Novo Nordisk
Conditions Approved	na
Conditions Active	Head and neck cancer, Non-small cell lung cancer, Cervical cancer, Chronic lymphocytic leukaemia, Endometrial cancer, Fallopian tube cancer, Ovarian cancer, Peritoneal cancer, Solid tumours, Haematological malignancies
Conditions Discontinued	Inflammation, Rheumatoid arthritis
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy