Thera-SAbDab

TISLELIZUMAB

> Structural Summary

Therapeutic	Tislelizumab
Target	PDCD1
Heavy Chain	QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIYADGSTNYNPSLKSRVTISKDTSKNQVSLKLSSVTAADTAVYYCARAYGNYWYIDVWGQGTTVTVSS
Light Chain	DIVMTQSPDSLAVSLGERATINCKSSESVSNDVAWYQQKPGQPPKLLINYAFHRFTGVPDRFSGSGYGTDFTLTISSLQAEDVAVYYCHQAYSSPYTFGQGTKLEIK
100% seqID Fv Structure	7bxa [Fvs: BC, HL], 7cgw [Fvs: AB, HL]
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

100% seqID Structure	7bxa [Fvs: BC, HL]
100% seqID Structure	7cgw [Fvs: AB, HL]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (January '23)	Approved
Estimated Status (January '23)	Active
Recorded Developmental Technology	na
INN Year Proposed	2017
INN Year Recommended	2018
Companies Involved	BeiGene, Celgene Corporation
Conditions Approved	Hodgkin's disease, Urogenital cancer
Conditions Active	Gastric cancer, Liver cancer, Nasopharyngeal cancer, Non-small cell lung cancer, Oesophageal cancer, Lung cancer, Lymphoma, Solid tumours, Ovarian cancer, Renal cancer
Conditions Discontinued	na
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy