| Therapeutic | Infliximab |
| Target | TNF/TNFA |
| Heavy Chain | EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSS |
| Light Chain | DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVESEDIADYYCQQSHSWPFTFGSGTNLEVK |
| 100% seqID Fv Structure | 4g3y [Fvs: HL], 5vh3 [Fvs: AB, HL], 5vh4 [Fvs: AB, HL], 6ugs [Fvs: AB, HL], 6ugt [Fvs: AB, HL], 6ugu [Fvs: AB, HL], 6ugv [Fvs: AB, HL] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 5vh3 [Fvs: AB, HL] |
| 100% seqID Structure | 5vh4 [Fvs: AB, HL] |
| 100% seqID Structure | 4g3y [Fvs: HL] |
| 100% seqID Structure | 6ugs [Fvs: AB, HL] |
| 100% seqID Structure | 6ugv [Fvs: AB, HL] |
| 100% seqID Structure | 6ugt [Fvs: AB, HL] |
| 100% seqID Structure | 6ugu [Fvs: AB, HL] |
Follow these links to our prediction tools:
| Format | Whole mAb |
| Isotype | G1 |
| Highest Clinical Trial (Feb '25) | Approved |
| Estimated Status (Feb '25) | NFD |
| Recorded Developmental Technology | |
| INN Year Proposed | 1997 |
| INN Year Recommended | 1998 |
| Companies Involved | Centocor, Janssen Biotech, Merck & Co, Mitsubishi Tanabe Pharma Corporation, National Jewish Medical and Research Center, Xian-Janssen |
| Conditions Approved | Ankylosing spondylitis, Behcet's syndrome, Crohn's disease, Mucocutaneous lymph node syndrome, Plaque psoriasis, Psoriasis, Psoriatic arthritis, Rheumatoid arthritis, Ulcerative colitis |
| Conditions Active | na |
| Conditions Discontinued | Berylliosis, Hepatitis C, Pyoderma |
| Notes | Danvilostomig Fv1;Ipilimumab; Sovipostobart; and Tazlestobart all have the same sequence. Likely biosimilars. |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]