Therapeutic | Ociperlimab |
Target | TIGIT/WUCAM/VSTM3 |
Heavy Chain | EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWVRQAPGKGLEWVAYITKGGGSTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARQTNYDFTMDYWGQGTLVTVSS |
Light Chain | EIVMTQSPATLSVSPGERATLSCKASQDVGTSVAWYQQKPGQAPRLLIYWASARHTGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYSSYPLTFGGGTKVEIK |
100% seqID Fv Structure | 8jel [Fvs: AB, CD, FG, JK], 8jen [Fvs: AB, CD, EF, GH], 8jep [Fvs: AB, CD] |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
100% seqID Structure | 8jel [Fvs: AB, CD, FG, JK] |
100% seqID Structure | 8jen [Fvs: AB, CD, EF, GH] |
100% seqID Structure | 8jep [Fvs: AB, CD] |
Follow these links to our prediction tools:
Format | Whole mAb |
Isotype | G1 |
Highest Clinical Trial (Aug '24) | Phase-III |
Estimated Status (Aug '24) | Active |
Recorded Developmental Technology | |
INN Year Proposed | 2020 |
INN Year Recommended | 2021 |
Companies Involved | BeiGene |
Conditions Approved | na |
Conditions Active | Non-small cell lung cancer, Cervical cancer, Small-cell lung cancer, Squamous cell cancer, Solid tumours |
Conditions Discontinued | na |
Notes | June '22: Corrected CDRH1 sequence |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]