Thera-SAbDab

ERFONRILIMAB

>   Structural Summary
TherapeuticErfonrilimab
Target 1CD274
Heavy Chain 1QVQLVESGGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS
Light Chain 1na
100% seqID Fv 1 StructureNone
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2CTLA4
Heavy Chain 2QVQLVESGGGLVQPGGSLRLSCAASGYIYSAYCMGWFRQAPGKGLEGVAAIYIGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADVIPTETCLGGSWSGPFGYWGQGTLVTVSS
Light Chain 2na
100% seqID Fv 2 Structure6rqm [Fvs: B]
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific Single Domains (VH-VH'-CH)
IsotypeG1
Highest Clinical Trial (May '24)Phase-II
Estimated StatusActive
Recorded Developmental Technologyna
INN Year Proposed2020
INN Year RecommendedNone
Companies InvolvedAlphamab
Conditions Approvedna
Conditions ActiveNon-small cell lung cancer, Triple-negative breast cancer, Esophageal carcinoma
Conditions Discontinuedna
Notes(June '22: Corrected FWH1 sequence)

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy