Thera-SAbDab

CONATUMUMAB

> Structural Summary

Therapeutic	Conatumumab
Target	TNFRSF10B
Heavy Chain	QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYFWSWIRQLPGKGLEWIGHIHNSGTTYYNPSLKSRVTISVDTSKKQFSLRLSSVTAADTAVYYCARDRGGDYYYGMDVWGQGTTVTVSS
Light Chain	EIVLTQSPGTLSLSPGERATLSCRASQGISRSYLAWYQQKPGQAPSLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQFGSSPWTFGQGTKVEIK
100% seqID Fv Structure	4n90 [Fvs: DE, FG, HI]
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

100% seqID Structure	4n90 [Fvs: DE, FG, HI]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (January '23)	Phase-II
Estimated Status (January '23)	Active
Recorded Developmental Technology	Abgenix XenoMouse
INN Year Proposed	2008
INN Year Recommended	2009
Companies Involved	Amgen, Takeda
Conditions Approved	na
Conditions Active	Solid tumours
Conditions Discontinued	Colorectal cancer, Lymphoma, Non-small cell lung cancer, Pancreatic cancer, Sarcoma
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy