Therapeutic | Erfonrilimab |
Target 1 | CD274 |
Heavy Chain 1 | QVQLVESGGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS |
Light Chain 1 | na |
100% seqID Fv 1 Structure | None |
99% seqID Fv 1 Structure | None |
95-98% seqID Fv 1 Structure | None |
Target 2 | CTLA4 |
Heavy Chain 2 | QVQLVESGGGLVQPGGSLRLSCAASGYIYSAYCMGWFRQAPGKGLEGVAAIYIGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADVIPTETCLGGSWSGPFGYWGQGTLVTVSS |
Light Chain 2 | na |
100% seqID Fv 2 Structure | 6rqm [Fvs: B] |
99% seqID Fv 2 Structure | None |
95-98% seqID Fv 2 Structure | None |
100% seqID Structure [Fv 2] | 6rqm [Fvs: B] |
There are no identical PDB matches to at least one Fv in this therapeutic. Click the links to build models with ABodyBuilder: [Fv 1] [Fv 2] |
Follow these links to our prediction tools:
Format | Bispecific Single Domains (VH-VH'-CH) |
Isotype | G1 |
Highest Clinical Trial (Aug '23) | Phase-III |
Estimated Status (Aug '23) | Active |
Recorded Developmental Technology | na |
INN Year Proposed | 2020 |
INN Year Recommended | 2021 |
Companies Involved | Alphamab |
Conditions Approved | na |
Conditions Active | Non-small cell lung cancer, Triple-negative breast cancer, Esophageal carcinoma |
Conditions Discontinued | na |
Notes | (June '22: Corrected FWH1 sequence) |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]