PDB | 4odh |
Chain | H |
CDR | CDRH3 |
Definition | imgt |
Sequence | AKDLGESENEEWATDYYDFSIGYPGQDPRGVVGAFDI |
Species | HOMO SAPIENS |
Method | X-RAY DIFFRACTION |
Resolution | 2.894Å |
Please note the WebGL plugin needs to be enabled to use PV Viewer.
|
|
Display options: |
Definition: imgt
105 | 106 | 107 | 108 | 109 | 110 | 111 | 111A | 111B | 111C | 111D | 111E | 111F | 111G | 111H | 111I | 111J | 111K | 111L | 112L | 112K | 112J | 112I | 112H | 112G | 112F | 112E | 112D | 112C | 112B | 112A | 112 | 113 | 114 | 115 | 116 | 117 |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
A | K | D | L | G | E | S | E | N | E | E | W | A | T | D | Y | Y | D | F | S | I | G | Y | P | G | Q | D | P | R | G | V | V | G | A | F | D | I |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]