Thera-SAbDab

IANALUMAB

> Structural Summary

Therapeutic	Ianalumab
Target	TNFRSF13C/CD268/BAFFR/BR3
Heavy Chain	QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWGWIRQSPGRGLEWLGRIYYRSKWYNSYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARYDWVPKIGVFDSWGQGTLVTVSS
Light Chain	DIVLTQSPATLSLSPGERATLSCRASQFISSSYLSWYQQKPGQAPRLLIYGSSSRATGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQLYSSPMTFGQGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	Phase-III
Estimated Status (Feb '25)	Active
Recorded Developmental Technology	POTELLIGENT Technology
INN Year Proposed	2017
INN Year Recommended	2018
Companies Involved	H. Lee Moffitt Cancer Center and Research Institute, MorphoSys, Novartis
Conditions Approved	na
Conditions Active	Autoimmune hepatitis, Idiopathic pulmonary fibrosis, Multiple sclerosis, Pemphigus vulgaris, Rheumatoid arthritis, Sjogren's syndrome, Systemic lupus erythematosus
Conditions Discontinued	Chronic lymphocytic leukaemia
Notes	Feb '22: Residue 108 changed from Q to D according to amendment in RL83. (June '22) Corrected CDRL1/CDRL3 sequences.

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy