Thera-SAbDab

IMSIDOLIMAB

> Structural Summary

Therapeutic	Imsidolimab
Target	IL36R
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWMNWVRQAPRQGLEWMGMFHPTGDVTRLNQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARTTSMIIGGFAYWGQGTLVTVSS
Light Chain	DIVMTQTPLSLSVTPGQPASISCRSSKSLLHRNAITYFYWYLHKPGQPPQLLIYQMSNLASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELPLTFGGGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (Feb '25)	Phase-III
Estimated Status (Feb '25)	Active
Recorded Developmental Technology
INN Year Proposed	2020
INN Year Recommended	2021
Companies Involved	AnaptysBio
Conditions Approved	na
Conditions Active	Generalised pustular psoriasis, Localised pustular psoriasis, Acneiform eruptions, Ichthyosis
Conditions Discontinued	Palmoplantas pustulosis, Acne vulgaris, Hidradenitis suppurative
Notes	Genetics: musmus/homosap

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy