Thera-SAbDab

ITOLIZUMAB

> Structural Summary

Therapeutic	Itolizumab
Target	CD6
Heavy Chain	EVQLVESGGGLVKPGGSLKLSCAASGFKFSRYAMSWVRQAPGKRLEWVATISSGGSYIYYPDSVKGRFTISRDNVKNTLYLQMSSLRSEDTAMYYCARRDYDLDYFDSWGQGTLVTVSS
Light Chain	DIQMTQSPSSLSASVGDRVTITCKASRDIRSYLTWYQQKPGKAPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPFTLGSGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology
INN Year Proposed	2010
INN Year Recommended	2011
Companies Involved	Center of Molecular Immunology, Biocon, Biotech Pharmaceutical, Equillium
Conditions Approved	Plaque psoriasis
Conditions Active	Graft-versus-host disease, Cytokine release syndrome, COVID-19, Asthma, Lupus nephritis
Conditions Discontinued	Autoimmune disorders, Multiple sclerosis, Psoriasis, Rheumatoid arthritis
Notes	ADC with debotansine or tazide

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy